2O2O: Domain B from human CIN85 PROTEIN

Solution structure of domain B from human CIN85 PROTEIN. Determined by solution NMR. Released 13 Nov 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 600
Mol. weight: 10.5 kDa
Released: 13 Nov 2007

Explore 2O2O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2O2O contains 1 α-helix and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	102-105	4	1
β-strand	109	1	2
β-strand	119	1	2
β-strand	124-126	3	1
α-helix	130-132	3
β-strand	136	1	3
β-strand	139-140	2	1
β-strand	143-144	2	1
β-strand	147	1	3
β-strand	152-153	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SH3-domain kinase-binding protein 1	A	protein	92	Homo sapiens	Q96B97 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2O2O_1 SH3-domain kinase-binding protein 1 (chains A)
SMTGGQQMGTNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNG
KTGMFPSNFIKELSGESDELGISQDEHHHHHH

Primary citation

Investigation of Domain B from Human Cin85 Protein: Structure, Dynamics and Proline-Rich Motif Binding. Ababou, A., Pfuhl, M., Dikic, I. et al. To be published.

Other PDB entries of the same protein (UniProt Q96B97 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ABS 1.74 Å, Crystal structure of the C-terminal coiled-coil domain of CIN85 in space group P321
2BZ8 2.0 Å, N-terminal Sh3 domain of CIN85 bound to Cbl-b peptide
2YDL 2.05 Å, Crystal structure of SH3C from CIN85
2K6D CIN85 Sh3-C domain in complex with ubiquitin
2K9G Solution structure of the third SH3 domain of the Cin85 adapter protein
2N64 NMR Structure of the C-terminal Coiled-Coil Domain of CIN85

Browse structure collections

About this viewer

MolViewer shows 2O2O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.