2KBX: ILK-PINCH complex

Solution structure of ILK-PINCH complex. Determined by solution NMR. Released 30 Dec 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,915
Mol. weight: 27.47 kDa
Ligands: ZN
Released: 30 Dec 2008

Explore 2KBX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KBX contains 14 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	3-8	6
α-helix	13-20	8
α-helix	37-44	8
α-helix	47-56	10
α-helix	70-77	8
α-helix	80-87	8
α-helix	92-94	3
α-helix	103-110	8
α-helix	113-120	8
α-helix	136-141	6
α-helix	147-153	7

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	1
β-strand	16	1	1
β-strand	24-27	4	2
β-strand	29-31	3	2
β-strand	37	1	3
β-strand	44	1	3
α-helix	45	1
α-helix	46-48	3
β-strand	51-53	3	4
β-strand	56-58	3	4
α-helix	60-67	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin-linked protein kinase	A	protein	171	Homo sapiens	Q13418 (AlphaFold model)
LIM and senescent cell antigen-like-containing domain protein 1	B	protein	70	Homo sapiens	P48059 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KBX_1 Integrin-linked protein kinase (chains A)
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKG

Sequence of entity 2 (B), FASTA

>2KBX_2 LIM and senescent cell antigen-like-containing domain protein 1 (chains B)
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCE
HDFQMLFAPC

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Cytosketal proteins. Qin, J. To be published.

Other PDB entries of the same protein (UniProt Q13418 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HI8 1.2 Å, Structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1 LIM1…
4HI9 1.2 Å, 1.2 structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1…
9TP9 1.45 Å, Crystal structure of integrin-linked kinase (ILK) in complex with Alpha-Parvin and…
9D5E 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to gefitinib
9D5F 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to bosutinib
9D5H 1.5 Å, Crystal structure of the ILK mutant (R371Q)/alpha-parvin core complex bound to gefitinib
9D5I 1.5 Å, Crystal structure of the ILK mutant (R225A)/alpha-parvin core complex bound to MgATP
9D5P 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to erlotinib
9TPD 1.5 Å, Crystal structure of integrin-linked kinase (ILK) in complex with alpha-parvin and a…
9D5G 1.55 Å, Crystal structure of the ILK/alpha-parvin core complex bound to 4-methyl erlotinib
3F6Q 1.6 Å, Crystal structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1…
3KMU 1.8 Å, Crystal structure of the ILK/alpha-parvin core complex (apo)

Browse structure collections

About this viewer

MolViewer shows 2KBX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.