2KC0: Factor H binding protein

Solution structure of the factor H binding protein. Determined by solution NMR. Released 17 Feb 2009.

Method: Solution NMR
Organism: Neisseria meningitidis
Chains: 1
Atoms: 1,828
Mol. weight: 27.46 kDa
Released: 17 Feb 2009

Explore 2KC0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KC0 contains 3 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	16-21	6
β-strand	33-35	3	1
β-strand	45-50	6	2
β-strand	53-58	6	2
β-strand	62-64	3	1
α-helix	69	1
β-strand	72-84	13	2
β-strand	87-100	14	2
β-strand	105-115	11	2
β-strand	123-135	13	2
β-strand	150-158	9	3
β-strand	165-171	7	3
β-strand	176-182	7	3
α-helix	187-189	3
β-strand	191-198	8	3
β-strand	207-212	6	3
β-strand	219-227	9	3
β-strand	233-242	10	3
β-strand	245-254	10	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
lipoprotein	A	protein	255	Neisseria meningitidis	Q6QCC2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KC0_1 lipoprotein (chains A)
MVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTG
KLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAK
RQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKS
PELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGI
RHIGLAAKQHHHHHH

Primary citation

Solution Structure of the Factor H-binding Protein, a Survival Factor and Protective Antigen of Neisseria meningitidis. Cantini, F., Veggi, D., Dragonetti, S. et al. J Biol Chem (2009) 284:9022-9026. DOI 10.1074/jbc.C800214200 · PubMed

Other PDB entries of the same protein (UniProt Q6QCC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KVD 2.0 Å, Crystal structure of the Neisseria meningitidis Factor H binding protein, fHbp (GNA1870)…
6TIK 3.4 Å, Hepatitis B virus core shell--virus-like particle with NadA epitope

Browse structure collections

About this viewer

MolViewer shows 2KC0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.