Solution structure of protein ITSN1 from Homo sapiens. Northeast Structural Genomics Consortium target HR5524A. Determined by solution NMR. Released 31 Mar 2009.
Explore 2KGR in 3D Show helices and sheets RCSB PDB PDBe
2KGR contains 7 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-21 | 12 | |
| β-strand | 30-32 | 3 | 1 |
| α-helix | 33-41 | 9 | |
| α-helix | 47-57 | 11 | |
| β-strand | 64-66 | 3 | 1 |
| α-helix | 67-81 | 15 | |
| α-helix | 84-87 | 4 | |
| α-helix | 92-94 | 3 | |
| α-helix | 96 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Intersectin-1 | A | protein | 111 | Homo sapiens | Q15811 (AlphaFold model) |
>2KGR_1 Intersectin-1 (chains A) PPVAEWAVPQSSRLKYRQLFNSHDKTMSGHLTGPQARTILMQSSLPQAQLASIWNLSDID QDGKLTAEEFILAMHLIDVAMSGQPLPPVLPPEYIPPSFRRVRLEHHHHHH
Solution structure of protein ITSN1 from Homo sapiens. Northeast Structural Genomics Consortium target HR5524A. Wu, Y., Ghosh, A., Shastry, R. et al. To be published.
Other PDB entries of the same protein (UniProt Q15811 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2KGR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.