2KJE: CBP TAZ2 and adenoviral E1A complex

NMR structure of CBP TAZ2 and adenoviral E1A complex. Determined by solution NMR. Released 15 Sept 2009.

Method: Solution NMR
Organisms: Homo sapiens, Human adenovirus 5
Chains: 2
Atoms: 1,038
Mol. weight: 15.19 kDa
Ligands: ZN
Released: 15 Sept 2009

Explore 2KJE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KJE contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	1766-1785	20
α-helix	1794-1806	13
α-helix	1812-1815	4
α-helix	1818-1833	16
α-helix	1842-1854	13

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	59-63	5
α-helix	72-74	3
α-helix	80-82	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CREB-binding protein	A	protein	92	Homo sapiens	Q92793 (AlphaFold model)
Early E1A 32 kDa protein	B	protein	42	Human adenovirus 5	P03255 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KJE_1 CREB-binding protein (chains A)
SPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQL
IALCCYHAKHCQENKCPVPFCLNIKHKLRQQQ

Sequence of entity 2 (B), FASTA

>2KJE_2 Early E1A 32 kDa protein (chains B)
SHMAPEDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Structural basis for subversion of cellular control mechanisms by the adenoviral E1A oncoprotein. Ferreon, J.C., Martinez-Yamout, M.A., Dyson, H.J. et al. Proc Natl Acad Sci U S A (2009) 106:13260-13265. DOI 10.1073/pnas.0906770106 · PubMed

Other PDB entries of the same protein (UniProt Q92793 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5I86 1.05 Å, Crystal structure of the bromodomain of human CREBBP bound to the benzodiazepinone…
5J0D 1.05 Å, Crystal structure of the bromodomain of human CREBBP in complex with a benzoxazepine…
5I89 1.07 Å, Crystal structure of the bromodomain of human CREBBP bound to the benzodiazepinone…
5KTW 1.09 Å, CREBBP bromodomain in complex with Cpd 44 (3-((5-acetyl-1-(cyclopropylmethyl)-4,5,6,7-tet…
4NYX 1.1 Å, Crystal Structure of the Bromodomain of human CREBBP in complex with a…
5EP7 1.2 Å, Crystal structure of the bromodomain of human CREBBP in complex with UN32
4NR7 1.2 Å, Crystal structure of the bromodomain of human CREBBP in complex with an…
6YIL 1.22 Å, Crystal structure of the CREBBP bromodomain in complex with a tetrahydroquinoxaline ligand
5MMG 1.23 Å, Crystal structure of CREBBP bromodomain complexed with UT07C
5MPN 1.23 Å, Crystal structure of CREBBP bromodomain complexed with FA26
6YIM 1.23 Å, Crystal structure of the CREBBP bromodomain in complex with a benzo-diazepine ligand
7WX2 1.24 Å, CBP-BrD complexed with NEO2734

Browse structure collections

About this viewer

MolViewer shows 2KJE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.