2KKC: P62 PB1 domain

NMR structure of the p62 PB1 domain. Determined by solution NMR. Released 15 Sept 2009.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 1
Atoms: 791
Mol. weight: 11.43 kDa
Released: 15 Sept 2009

Explore 2KKC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KKC contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	3-11	9	1
β-strand	17-26	10	1
α-helix	41-52	12
β-strand	61-66	6	1
β-strand	72-75	4	1
α-helix	78-87	10
β-strand	92-99	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sequestosome-1	A	protein	102	Rattus norvegicus	O08623 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KKC_1 Sequestosome-1 (chains A)
GPHMSLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAAAGPGPCERLLSRVAVLFPALRP
GGFQAHYRAERGDLVAFSSDEELTMAMSYVKDDIFRIYIKEK

Primary citation

The NMR structure of the p62 PB1 domain, a key protein in autophagy and NF-kappaB signaling pathway. Saio, T., Yokochi, M., Inagaki, F. J Biomol NMR (2009) 45:335-341. DOI 10.1007/s10858-009-9370-7 · PubMed

Other PDB entries of the same protein (UniProt O08623 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2K6Q LC3 p62 complex structure
2KTR NMR structure of p62 PB1 dimer determined based on PCS

Browse structure collections

About this viewer

MolViewer shows 2KKC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.