2KTR: P62 PB1 dimer determined based on PCS

NMR structure of p62 PB1 dimer determined based on PCS. Determined by solution NMR. Released 7 Apr 2010.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 2
Atoms: 1,549
Mol. weight: 24.39 kDa
Ligands: TB
Released: 7 Apr 2010

Explore 2KTR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KTR contains 4 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	4-11	8	1
β-strand	17-25	9	1
α-helix	41-52	12
β-strand	61-66	6	1
β-strand	72-75	4	1
α-helix	78-87	10
β-strand	92-99	8	1

Chain B: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	203-211	9	2
β-strand	217-226	10	2
α-helix	241-252	12
β-strand	261-266	6	2
β-strand	272-275	4	2
α-helix	278-287	10
β-strand	292-299	8	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sequestosome-1	A	protein	117	Rattus norvegicus	O08623 (AlphaFold model)
Sequestosome-1	B	protein	100	Rattus norvegicus	O08623 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KTR_1 Sequestosome-1 (chains A)
CYVDTNNDGAYEGDELHMGSLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAAAGPGPSE
RLLSRVAVLFPALRPGGFQAHYRAERGDLVAFSSDEELTMAMSYVKDDIFRIYIKEK

Sequence of entity 2 (B), FASTA

>2KTR_2 Sequestosome-1 (chains B)
HMSLTVEAYLLGKEEAAREIRRFSFSFSPEPEAEAAAGPGPSERLLSRVAVLFPALRPGG
FQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFAIYIKEK

Ligands and cofactors

ID	Name	Formula	Copies
TB	Terbium(iii) ion	Tb	1

Primary citation

PCS-based structure determination of protein-protein complexes. Saio, T., Yokochi, M., Kumeta, H. et al. J Biomol NMR (2010) 46:271-280. DOI 10.1007/s10858-010-9401-4 · PubMed

Other PDB entries of the same protein (UniProt O08623 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2K6Q LC3 p62 complex structure
2KKC NMR structure of the p62 PB1 domain

Browse structure collections

About this viewer

MolViewer shows 2KTR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.