Solution NMR Structure of BCMA. Determined by solution NMR. Released 23 Feb 2011.
Explore 2KN1 in 3D Show helices and sheets RCSB PDB PDBe
2KN1 contains 2 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-13 | 3 | 1 |
| β-strand | 20-22 | 3 | 1 |
| α-helix | 24-27 | 4 | |
| α-helix | 37-40 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tumor necrosis factor receptor superfamily member 17 | A | protein | 51 | Homo sapiens | Q02223 (AlphaFold model) |
>2KN1_1 Tumor necrosis factor receptor superfamily member 17 (chains A) LQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKCX
Structure of the extracellular domains of human and Xenopus Fn14: implications in the evolution of TWEAK and Fn14 interactions. Pellegrini, M., Willen, L., Perroud, M. et al. FEBS J (2013) 280:1818-1829. DOI 10.1111/febs.12206 · PubMed
Other PDB entries of the same protein (UniProt Q02223 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2KN1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.