8HXQ: Nanobody1

Nanobody1 in complex with human BCMA ECD. Determined by X-ray diffraction at 2.4 Å resolution. Released 3 Jan 2024.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Vicugna pacos, Homo sapiens
Chains: 4
Atoms: 2,540
Mol. weight: 39.66 kDa
Released: 3 Jan 2024

Explore 8HXQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HXQ contains 10 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	18-24	7	1
β-strand	32-39	8	2
β-strand	46-51	6	2
α-helix	53-55	3
β-strand	58-60	3	2
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-100	9	2
β-strand	108-109	2	2
β-strand	113-118	6	2

Chain B: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	4
β-strand	10-13	4	5
β-strand	18-24	7	4
β-strand	32-39	8	5
α-helix	44-45	2
β-strand	46-51	6	5
α-helix	53-55	3
β-strand	58-60	3	5
β-strand	68-73	6	4
β-strand	78-83	6	4
α-helix	88-90	3
β-strand	92-100	9	5
β-strand	108-109	2	5
β-strand	113-118	6	5

Chain C: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	2
β-strand	12-15	4	3
β-strand	20-23	4	3
α-helix	24-26	3
α-helix	35-37	3
α-helix	38-42	5

Chain D: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	5
β-strand	12-15	4	6
β-strand	20-23	4	6
α-helix	24-26	3
α-helix	35-42	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nanobody1	A, B	protein	125	Vicugna pacos
Tumor necrosis factor receptor superfamily member 17	C, D	protein	54	Homo sapiens	Q02223 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8HXQ_1 Nanobody1 (chains A, B)
QVKLEESGGGLVQAGRSLRLSCAASEHTFSSHVMGWFRQAPGKERESVAVIGWRDISTSY
ADSVKGRFTISRDNAKKTLYLQMNSLKPEDTAVYYCAARRIDAADFDSWGQGTQVTVSSH
HHHHH

Sequence of entity 2 (C, D), FASTA

>8HXQ_2 Tumor necrosis factor receptor superfamily member 17 (chains C, D)
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Primary citation

Antigen-induced chimeric antigen receptor multimerization amplifies on-tumor cytotoxicity. Sun, Y., Yang, X.N., Yang, S.S. et al. Signal Transduct Target Ther (2023) 8:445-445. DOI 10.1038/s41392-023-01686-z · PubMed

Other PDB entries of the same protein (UniProt Q02223 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ZFO 1.9 Å, J22.9-xi: chimeric mouse/human antibody against human BCMA (CD269)
1XU2 2.35 Å, The crystal structure of APRIL bound to BCMA
1OQD 2.6 Å, Crystal structure of sTALL-1 and BCMA
6J7W 2.6 Å, Crystal Structure of Human BCMA in complex with UniAb(TM) VH
8HXR 2.7 Å, Nanobody2 in complex with human BCMA ECD
8QYA 2.72 Å, J22.9-FNY, fully humanized, CDR optimized Fab Fragment based on chimeric J22.9-xi IgG…
12ER 2.99 Å, Cryo-EM structure of BCMA in complex with the BCMA-targeted Fab arm of teclistamab and…
8QYB 3.09 Å, J22.9-ISY, fully humanized and CDR optimized Fab Fragment based on chimeric J22.9-xi IgG…
8QY9 3.1 Å, J22.9-H, fully humanized Fab Fragment based on chimeric J22.9-xi IgG against BCMA
9MQO 3.18 Å, Crystal structure of BCMA in complex with CA10v2 Fab
12ES 3.43 Å, Cryo-EM structure of BCMA in complex with the BCMA-targeted Fab arm of linvoseltamab and…
2KN1 Solution NMR Structure of BCMA

Browse structure collections

About this viewer

MolViewer shows 8HXQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.