6J7W: Human BCMA

Crystal Structure of Human BCMA in complex with UniAb(TM) VH. Determined by X-ray diffraction at 2.6 Å resolution. Released 6 Feb 2019.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,345
Mol. weight: 33.89 kDa
Released: 6 Feb 2019

Explore 6J7W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6J7W contains 7 α-helices and 26 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	46-51	6	2
β-strand	58-60	3	2
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-99	8	2
β-strand	106-109	4	2
β-strand	113-117	5	2

Chain C: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	11-14	4	3
β-strand	19-22	4	3
α-helix	24-27	4

Chain D: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	11-14	4	6
β-strand	19-22	4	6
α-helix	23-25	3
α-helix	34-36	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
UniAb	A, B	protein	118	Homo sapiens
Tumor necrosis factor receptor superfamily member 17	C, D	protein	39	Homo sapiens	Q02223 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6J7W_1 UniAb (chains A, B)
EVQLVESGGGLVQPGGSLRLSCAASGFTVSSYGMSWVRQAPGKGPEWVSGIRGSDGSTYY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKQGENDGPFDHRGQGTLVTVS

Sequence of entity 2 (C, D), FASTA

>6J7W_2 Tumor necrosis factor receptor superfamily member 17 (chains C, D)
GQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNAS

Primary citation

Multispecific Antibody Development Platform Based on Human Heavy Chain Antibodies. Clarke, S.C., Ma, B., Trinklein, N.D. et al. Front Immunol (2018) 9:3037-3037. DOI 10.3389/fimmu.2018.03037 · PubMed

Other PDB entries of the same protein (UniProt Q02223 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ZFO 1.9 Å, J22.9-xi: chimeric mouse/human antibody against human BCMA (CD269)
1XU2 2.35 Å, The crystal structure of APRIL bound to BCMA
8HXQ 2.4 Å, Nanobody1 in complex with human BCMA ECD
1OQD 2.6 Å, Crystal structure of sTALL-1 and BCMA
8HXR 2.7 Å, Nanobody2 in complex with human BCMA ECD
8QYA 2.72 Å, J22.9-FNY, fully humanized, CDR optimized Fab Fragment based on chimeric J22.9-xi IgG…
12ER 2.99 Å, Cryo-EM structure of BCMA in complex with the BCMA-targeted Fab arm of teclistamab and…
8QYB 3.09 Å, J22.9-ISY, fully humanized and CDR optimized Fab Fragment based on chimeric J22.9-xi IgG…
8QY9 3.1 Å, J22.9-H, fully humanized Fab Fragment based on chimeric J22.9-xi IgG against BCMA
9MQO 3.18 Å, Crystal structure of BCMA in complex with CA10v2 Fab
12ES 3.43 Å, Cryo-EM structure of BCMA in complex with the BCMA-targeted Fab arm of linvoseltamab and…
2KN1 Solution NMR Structure of BCMA

Browse structure collections

About this viewer

MolViewer shows 6J7W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.