2KNH: ETAFH domain of AML1-ETO

The Solution structure of the eTAFH domain of AML1-ETO complexed with HEB peptide. Determined by solution NMR. Released 6 Oct 2009.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 956
Mol. weight: 13.61 kDa
Released: 6 Oct 2009

Explore 2KNH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KNH contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	271-284	14
α-helix	292-304	13
α-helix	310-320	11
α-helix	329-351	23
α-helix	355-357	3

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	15-18	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein CBFA2T1	A	protein	103	Homo sapiens	Q06455 (AlphaFold model)
Transcription factor 12	B	protein	18	Homo sapiens	Q99081 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KNH_1 Protein CBFA2T1 (chains A)
GAMGSGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEAT
NFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQ

Sequence of entity 2 (B), FASTA

>2KNH_2 Transcription factor 12 (chains B)
IGTDKELSDLLDFSAMFS

Primary citation

Structure of the AML1-ETO eTAFH domain-HEB peptide complex and its contribution to AML1-ETO activity. Park, S., Chen, W., Cierpicki, T. et al. Blood (2009) 113:3558-3567. DOI 10.1182/blood-2008-06-161307 · PubMed

Other PDB entries of the same protein (UniProt Q06455 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WQ6 2.0 Å, The tetramer structure of the nervy homolgy two (NHR2) domain of AML1-ETO is critical…
4JOL 2.91 Å, Complex structure of AML1-ETO NHR2 domain with HEB fragment
2DJ8 Solution Structure of zf-MYND Domain of Protein CBFA2TI (Protein MTG8)
2H7B Solution structure of the eTAFH domain from the human leukemia-associated fusion protein…
2KYG Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to…
2OD1 Solution structure of the MYND domain from human AML1-ETO
2ODD Solution structure of the MYND domain from AML1-ETO complexed with SMRT, a corepressor
2PP4 Solution Structure of ETO-TAFH refined in explicit solvent

Browse structure collections

About this viewer

MolViewer shows 2KNH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.