Complex structure of AML1-ETO NHR2 domain with HEB fragment. Determined by X-ray diffraction at 2.91 Å resolution. Released 26 Jun 2013.
Explore 4JOL in 3D Show helices and sheets RCSB PDB PDBe
4JOL contains 4 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 495-545 | 51 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 495-546 | 52 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein CBFA2T1 | A, B, C, D | protein | 64 | Homo sapiens | Q06455 (AlphaFold model) |
| Transcription factor 12 | E, F, G, H | protein | 25 | Homo sapiens | Q99081 (AlphaFold model) |
>4JOL_1 Protein CBFA2T1 (chains A, B, C, D) SEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRY SDAE
>4JOL_2 Transcription factor 12 (chains E, F, G, H) SPLQAKKVRKVPPGLPSSVYAPSPN
A stable transcription factor complex nucleated by oligomeric AML1-ETO controls leukaemogenesis. Sun, X.J., Wang, Z., Wang, L. et al. Nature (2013) 500:93-97. DOI 10.1038/nature12287 · PubMed
Other PDB entries of the same protein (UniProt Q06455 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4JOL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.