2KNX: Complement repeat CR17 from LRP-1

Solution Structure of complement repeat CR17 from LRP-1. Determined by solution NMR. Released 14 Apr 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 353
Mol. weight: 5.14 kDa
Ligands: CA
Released: 14 Apr 2010

Explore 2KNX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KNX contains 2 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	11-14	4	1
β-strand	19-22	4	1
α-helix	37-39	3
α-helix	41-43	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prolow-density lipoprotein receptor-related protein 1	A	protein	50	Homo sapiens	Q07954 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KNX_1 Prolow-density lipoprotein receptor-related protein 1 (chains A)
GSEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNST

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

Structure of the minimal interface between ApoE and LRP. Guttman, M., Prieto, J.H., Handel, T.M. et al. J Mol Biol (2010) 398:306-319. DOI 10.1016/j.jmb.2010.03.022 · PubMed

Other PDB entries of the same protein (UniProt Q07954 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1J8E 1.85 Å, Crystal structure of ligand-binding repeat CR7 from LRP
1CR8 Low density lipoprotein receptor-related protein complement repeat 8
1D2L NMR solution structure of complement-like repeat CR3 from the low density lipoprotein…
2FYJ NMR Solution structure of calcium-loaded LRP double module
2FYL Haddock model of the complex between double module of LRP, CR56, and first domain of…
2KNY Fusion construct of CR17 from LRP-1 and ApoE residues 130-149

Browse structure collections

About this viewer

MolViewer shows 2KNX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.