2KNY: LRP-1, linker, Apo-E

Fusion construct of CR17 from LRP-1 and ApoE residues 130-149. Determined by solution NMR. Released 14 Apr 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 584
Mol. weight: 8.44 kDa
Ligands: CA
Released: 14 Apr 2010

Explore 2KNY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KNY contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	11-13	3	1
β-strand	20-22	3	1
α-helix	23-26	4
α-helix	41-43	3
α-helix	129-136	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
LRP-1, linker, Apo-E	A	protein	80	Homo sapiens	P02649 (AlphaFold model), Q07954 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KNY_1 LRP-1, linker, Apo-E (chains A)
GSKLEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNSTGSGSGSGS
TEELRVRLASHLRKLRKRLL

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

Structure of the minimal interface between ApoE and LRP. Guttman, M., Prieto, J.H., Handel, T.M. et al. J Mol Biol (2010) 398:306-319. DOI 10.1016/j.jmb.2010.03.022 · PubMed

Other PDB entries of the same protein (UniProt P02649 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7FCR 1.4 Å, Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE)
8AX9 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)
8AX8 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P3121)
7FCS 1.6 Å, Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE)
1GS9 1.7 Å, Apolipoprotein E4, 22k domain
6NCO 1.71 Å, Fragment-based Discovery of an apoE4 Stabilizer
1OR3 1.73 Å, Apolipoprotein E3 (APOE3), trigonal truncation mutant 165
8CE0 1.75 Å, N-terminal domain of human apolipoprotein E
1NFN 1.8 Å, Apolipoprotein E3 (APOE3)
6NCN 1.82 Å, Fragment-based Discovery of an apoE4 Stabilizer
1BZ4 1.85 Å, Apolipoprotein E3 (apo-E3), truncation mutant 165
9SA6 1.89 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)

Browse structure collections

About this viewer

MolViewer shows 2KNY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.