Solution structure of peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei complexed with Cycloheximide-N-ethylethanoate. Determined by solution NMR. Released 29 Sept 2009.
Explore 2KO7 in 3D Show helices and sheets RCSB PDB PDBe
2KO7 contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-9 | 2 | 1 |
| β-strand | 15-20 | 6 | 1 |
| β-strand | 26 | 1 | 2 |
| β-strand | 32-41 | 10 | 1 |
| β-strand | 46-49 | 4 | 1 |
| α-helix | 50-52 | 3 | |
| β-strand | 57-60 | 4 | 1 |
| α-helix | 68-74 | 7 | |
| β-strand | 78 | 1 | 2 |
| β-strand | 82-87 | 6 | 1 |
| α-helix | 89-91 | 3 | |
| β-strand | 108-116 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peptidyl-prolyl cis-trans isomerase | A | protein | 117 | Burkholderia pseudomallei | Q63J95 (AlphaFold model) |
>2KO7_1 Peptidyl-prolyl cis-trans isomerase (chains A) GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFV LGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
| ID | Name | Formula | Copies |
|---|---|---|---|
| JZF | ethyl (4-{(2R)-2-[(1S,3S,5S)-3,5-dimethyl-2-oxocyclohexyl]-2-hydroxyethyl}-2,6-… | C19 H29 N O6 | 1 |
The structure of a Burkholderia pseudomallei immunophilin-inhibitor complex reveals new approaches to antimicrobial development. Norville, I.H., O'Shea, K., Sarkar-Tyson, M. et al. Biochem J (2011) 437:413-422. DOI 10.1042/BJ20110345 · PubMed
Other PDB entries of the same protein (UniProt Q63J95 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2KO7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.