2KO7: Peptidyl-prolyl cis-trans isomerase

Name: PDB 2KO7: Solution structure of peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei complexed with Cycloheximide-N-ethylethanoate
Published: 2009-09-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: isomerase

Solution structure of peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei complexed with Cycloheximide-N-ethylethanoate. Determined by solution NMR. Released 29 Sept 2009.

Method: Solution NMR
Organism: Burkholderia pseudomallei
Chains: 1
Atoms: 886
Mol. weight: 12.61 kDa
Ligands: JZF
Released: 29 Sept 2009

Explore 2KO7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KO7 contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	8-9	2	1
β-strand	15-20	6	1
β-strand	26	1	2
β-strand	32-41	10	1
β-strand	46-49	4	1
α-helix	50-52	3
β-strand	57-60	4	1
α-helix	68-74	7
β-strand	78	1	2
β-strand	82-87	6	1
α-helix	89-91	3
β-strand	108-116	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptidyl-prolyl cis-trans isomerase	A	protein	117	Burkholderia pseudomallei	Q63J95 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KO7_1 Peptidyl-prolyl cis-trans isomerase (chains A)
GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFV
LGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV

Ligands and cofactors

ID	Name	Formula	Copies
JZF	ethyl (4-{(2R)-2-[(1S,3S,5S)-3,5-dimethyl-2-oxocyclohexyl]-2-hydroxyethyl}-2,6-…	C19 H29 N O6	1

Primary citation

The structure of a Burkholderia pseudomallei immunophilin-inhibitor complex reveals new approaches to antimicrobial development. Norville, I.H., O'Shea, K., Sarkar-Tyson, M. et al. Biochem J (2011) 437:413-422. DOI 10.1042/BJ20110345 · PubMed

Other PDB entries of the same protein (UniProt Q63J95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Y78 0.91 Å, Crystal structure of BPSS1823, a Mip-like chaperone from Burkholderia pseudomallei
3UQA 1.55 Å, Crystal structure of a SMT fusion Peptidyl-prolyl cis-trans isomerase with surface…
8P3C 2.02 Å, Full length structure of BpMIP with bound inhibitor NJS227.
5V8T 2.1 Å, Crystal structure of SMT fusion Peptidyl-prolyl cis-trans isomerase from Burkholderia…
2KE0 Solution structure of peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei

Browse structure collections

About this viewer

MolViewer shows 2KO7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.