Full length structure of BpMIP with bound inhibitor NJS227. Determined by X-ray diffraction at 2.02 Å resolution. Released 12 Jun 2024.
Explore 8P3C in 3D Show helices and sheets RCSB PDB PDBe
8P3C contains 6 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -6--3 | 4 | |
| β-strand | 4-5 | 2 | 1 |
| β-strand | 11-16 | 6 | 1 |
| α-helix | 21 | 1 | |
| β-strand | 22 | 1 | 2 |
| α-helix | 23 | 1 | |
| β-strand | 28-37 | 10 | 1 |
| β-strand | 42-45 | 4 | 1 |
| β-strand | 53-56 | 4 | 1 |
| α-helix | 64-69 | 6 | |
| β-strand | 74 | 1 | 2 |
| β-strand | 78-83 | 6 | 1 |
| α-helix | 85-87 | 3 | |
| β-strand | 94 | 1 | 3 |
| β-strand | 98 | 1 | 3 |
| α-helix | 99 | 1 | |
| β-strand | 104-112 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peptidyl-prolyl cis-trans isomerase | B | protein | 126 | Burkholderia pseudomallei | Q63J95 (AlphaFold model) |
>8P3C_1 Peptidyl-prolyl cis-trans isomerase (chains B) MHHHHHHENLYFQGTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSK DRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFE VELLDV
| ID | Name | Formula | Copies |
|---|---|---|---|
| WRX | (2~{S})-1-[(4-fluorophenyl)methylsulfonyl]-~{N}-[(2~{S})-3-(4-fluorophenyl)-1-o… | C28 H30 F2 N4 O4 S | 1 |
Water and common crystallization additives (PEG, GOL) are not listed.
Structure and Dynamics of Macrophage Infectivity Potentiator Proteins from Pathogenic Bacteria and Protozoans Bound to Fluorinated Pipecolic Acid Inhibitors. Perez Carrillo, V.H., Whittaker, J.J., Wiedemann, C. et al. J Med Chem (2025) 68:5926-5941. DOI 10.1021/acs.jmedchem.5c00134 · PubMed
Other PDB entries of the same protein (UniProt Q63J95 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8P3C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.