Crystal structure of SMT fusion Peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei complexed with SF354. Determined by X-ray diffraction at 2.1 Å resolution. Released 14 Mar 2018.
Explore 5V8T in 3D Show helices and sheets RCSB PDB PDBe
5V8T contains 14 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | -75--69 | 7 | 1 |
| β-strand | -64--58 | 7 | 1 |
| α-helix | -52--42 | 11 | |
| β-strand | -35--31 | 5 | 1 |
| β-strand | -28--27 | 2 | 1 |
| α-helix | -26--25 | 2 | |
| β-strand | -11--5 | 7 | 1 |
| β-strand | 4-5 | 2 | 2 |
| β-strand | 11-16 | 6 | 2 |
| α-helix | 21 | 1 | |
| β-strand | 22 | 1 | 3 |
| α-helix | 23 | 1 | |
| β-strand | 28-37 | 10 | 2 |
| β-strand | 42-45 | 4 | 2 |
| α-helix | 47-49 | 3 | |
| β-strand | 53-56 | 4 | 2 |
| α-helix | 64-70 | 7 | |
| β-strand | 74 | 1 | 3 |
| β-strand | 78-83 | 6 | 2 |
| α-helix | 85-87 | 3 | |
| β-strand | 94 | 1 | 4 |
| β-strand | 98 | 1 | 4 |
| β-strand | 104-112 | 9 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | -75--69 | 7 | 5 |
| β-strand | -64--58 | 7 | 5 |
| α-helix | -52--43 | 10 | |
| β-strand | -35--31 | 5 | 5 |
| β-strand | -28--27 | 2 | 5 |
| α-helix | -26--25 | 2 | |
| β-strand | -11--5 | 7 | 5 |
| β-strand | 4-5 | 2 | 6 |
| β-strand | 11-16 | 6 | 6 |
| α-helix | 21 | 1 | |
| β-strand | 22 | 1 | 7 |
| α-helix | 23 | 1 | |
| β-strand | 28-36 | 9 | 6 |
| β-strand | 42-45 | 4 | 6 |
| α-helix | 47-49 | 3 | |
| β-strand | 53-56 | 4 | 6 |
| α-helix | 64-69 | 6 | |
| β-strand | 74 | 1 | 7 |
| β-strand | 78-83 | 6 | 6 |
| α-helix | 85-87 | 3 | |
| β-strand | 94 | 1 | 8 |
| β-strand | 98 | 1 | 8 |
| β-strand | 104-112 | 9 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin-like protein SMT3,Peptidyl-prolyl cis-trans isomerase | A, B | protein | 208 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Burkholderia pseudomallei | Q12306 (AlphaFold model), Q63J95 (AlphaFold model) |
>5V8T_1 Ubiquitin-like protein SMT3,Peptidyl-prolyl cis-trans isomerase (chains A, B) GHHHHHHSGEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSL RFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGSTVVTTESGLKYEDLTEGSGAEARA GQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPP QLGYGARGAGGVIPPNATLVFEVELLDV
| ID | Name | Formula | Copies |
|---|---|---|---|
| 8ZV | 2-{[3,5-bis(2-methoxyethoxy)benzene-1-carbonyl]amino}ethyl… | C28 H38 N2 O9 S | 2 |
| MG | Magnesium ion | Mg | 1 |
Water and common crystallization additives (FMT) are not listed.
Crystal structure of SMT fusion Peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei complexed with SF354. Lorimer, D.D., Dranow, D.M., Seufert, F. et al. To be published.
Other PDB entries of the same protein (UniProt Q12306 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5V8T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.