Solution structure of the Autophagy-Related Protein Atg8. Determined by solution NMR. Released 5 May 2010.
Explore 2KQ7 in 3D Show helices and sheets RCSB PDB PDBe
2KQ7 contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 18-26 | 9 | |
| β-strand | 30-37 | 8 | 1 |
| β-strand | 51-54 | 4 | 1 |
| β-strand | 58 | 1 | 2 |
| α-helix | 59-69 | 11 | |
| β-strand | 79-81 | 3 | 1 |
| β-strand | 82 | 1 | 3 |
| β-strand | 85 | 1 | 3 |
| β-strand | 92 | 1 | 2 |
| α-helix | 93-99 | 7 | |
| β-strand | 107-112 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Autophagy-related protein 8 | A | protein | 119 | Saccharomyces cerevisiae | P38182 (AlphaFold model) |
>2KQ7_1 Autophagy-related protein 8 (chains A) GSMKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVG QFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR
Solution structure of Atg8 reveals conformational polymorphism of the N-terminal domain. Schwarten, M., Stoldt, M., Mohrluder, J. et al. Biochem Biophys Res Commun (2010). DOI 10.1016/j.bbrc.2010.04.043 · PubMed
Other PDB entries of the same protein (UniProt P38182 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2KQ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.