2KQS: Small ubiquitin-related modifier 1

Phosphorylation of SUMO-interacting motif by CK2 enhances Daxx SUMO binding activity. Determined by solution NMR. Released 1 Dec 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 928
Mol. weight: 13.59 kDa
Released: 1 Dec 2010

Explore 2KQS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KQS contains 3 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
β-strand	19	1	1
β-strand	22-27	6	2
β-strand	33-38	6	2
α-helix	44-55	12
β-strand	62-66	5	2
β-strand	69-70	2	2
α-helix	77-80	4
β-strand	86-92	7	2

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	736-738	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small ubiquitin-related modifier 1	A	protein	99	Homo sapiens	P63165 (AlphaFold model)
Death domain-associated protein 6	B	protein	22	Homo sapiens	Q9UER7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KQS_1 Small ubiquitin-related modifier 1 (chains A)
GSMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVP
MNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG

Sequence of entity 2 (B), FASTA

>2KQS_2 Death domain-associated protein 6 (chains B)
GSKTSVATQCDPEEIIVLSDSD

Primary citation

Structural and functional roles of Daxx SIM phosphorylation in SUMO paralog-selective binding and apoptosis modulation. Chang, C.C., Naik, M.T., Huang, Y.S. et al. Mol Cell (2011) 42:62-74. DOI 10.1016/j.molcel.2011.02.022 · PubMed

Other PDB entries of the same protein (UniProt P63165 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6UYR 1.3 Å, Crystal structure of K46-acetylated SUMO1 in complex with PML-SIM
4WJQ 1.35 Å, Crystal Structure of SUMO1 in complex with Daxx
6V7Q 1.35 Å, Crystal structure of SUMO1 in complex with phosphorylated PIAS-SIM2
6V7P 1.4 Å, Crystal structure of SUMO1 in complex with PIAS-SIM2
2UYZ 1.4 Å, Non-covalent complex between Ubc9 and SUMO1
6UYZ 1.4 Å, Crystal structure of K46-acetylated SUMO1 in complex with phosphorylated DAXX
6UYV 1.4 Å, Crystal structure of K46-acetylated SUMO1 in complex with phosphorylated PML-SIM
6UYP 1.42 Å, Crystal structure of K39-acetylated SUMO1 in complex with PML-SIM
4WJO 1.46 Å, Crystal Structure of SUMO1 in complex with PML
6V7S 1.47 Å, Crystal structure of K37-acetylated SUMO1 in complex with phosphorylated PIAS-SIM2
4WJN 1.5 Å, Crystal structure of SUMO1 in complex with phosphorylated PML
6UYQ 1.5 Å, Crystal structure of K45-acetylated SUMO1 in complex with PML-SIM

Browse structure collections

About this viewer

MolViewer shows 2KQS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.