2KRB: EIF3B-RRM

Solution structure of EIF3B-RRM bound to EIF3J peptide. Determined by solution NMR. Released 5 Jan 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 745
Mol. weight: 10.56 kDa
Released: 5 Jan 2010

Explore 2KRB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KRB contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	17-21	5	1
α-helix	31-43	13
β-strand	48-52	5	1
β-strand	56	1	2
β-strand	59	1	2
β-strand	63-68	6	1
α-helix	71-78	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 3 subunit B	A	protein	81	Homo sapiens	P55884 (AlphaFold model)
Eukaryotic translation initiation factor 3 subunit J	B	protein	11	Homo sapiens	O75822 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KRB_1 Eukaryotic translation initiation factor 3 subunit B (chains A)
DSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHA
VDAVKNADGYKLDKQHTFRVN

Sequence of entity 2 (B), FASTA

>2KRB_2 Eukaryotic translation initiation factor 3 subunit J (chains B)
DEDVKDNWDDD

Primary citation

The indispensable N-terminal half of eIF3j/HCR1 co-operates with its structurally conserved binding partner eIF3b/PRT1-RRM and eIF1A in stringent AUG selection. Elantak, L., Wagner, S., Herrmannova, A. et al. To be published.

Other PDB entries of the same protein (UniProt P55884 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZP4 2.9 Å, SARS-CoV-2 Nsp1 bound to a human 43S preinitiation ribosome complex - state 2
8PJ5 2.9 Å, Structure of human 48S translation initiation complex after eIF2 release prior 60S…
8PJ6 2.9 Å, Structure of human 48S translation initiation complex with initiator tRNA, eIF1A and…
6ZON 3.0 Å, SARS-CoV-2 Nsp1 bound to a human 43S preinitiation ribosome complex - state 1
8PJ4 3.2 Å, Structure of human 48S translation initiation complex after eIF5 release (48S-4)
8PJ1 3.4 Å, Structure of human 48S translation initiation complex in open codon scanning state (48S-1)
8PJ2 3.4 Å, Structure of human 48S translation initiation complex in AUG recognition state after…
7A09 3.5 Å, Structure of a human ABCE1-bound 43S pre-initiation complex - State III
8OZ0 3.5 Å, Structure of a human 48S translation initiation complex with eIF4F and eIF4A
8XXN 3.6 Å, Cryo-EM structure of the human 43S ribosome with PDCD4
6ZMW 3.7 Å, Structure of a human 48S translational initiation complex
7QP7 3.7 Å, Structure of the human 48S initiation complex in closed state (h48S AUG closed)

Browse structure collections

About this viewer

MolViewer shows 2KRB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.