2KUO: Aprataxin and PNK-like factor

Structure and identification of ADP-ribose recognition motifs of APLF and role in the DNA damage response. Determined by solution NMR. Released 5 May 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 721
Mol. weight: 10.4 kDa
Ligands: ZN
Released: 5 May 2010

Explore 2KUO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KUO contains 8 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	375-376	2
β-strand	377-378	2	1
α-helix	382-384	3
α-helix	390-395	6
β-strand	396-397	2	1
α-helix	409-412	4
α-helix	419	1
β-strand	420	1	2
α-helix	421	1
α-helix	424-426	3
α-helix	432-437	6
β-strand	439	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Aprataxin and PNK-like factor	A	protein	91	Homo sapiens	Q8IW19 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KUO_1 Aprataxin and PNK-like factor (chains A)
GSKATDSVLQGSEGNKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDD
RPECPYGPSCYRKNPQHKIEYRHNTLPVRNV

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structure and identification of ADP-ribose recognition motifs of aprataxin PNK-like factor (APLF) required for the interaction with sites of DNA damage response. Li, G.Y., McCulloch, R.D., Fenton, A. et al. To be published.

Other PDB entries of the same protein (UniProt Q8IW19 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W7W 1.35 Å, Crystal Structure of FHA domain of human APLF
5E50 1.38 Å, APLF/XRCC4 complex
6TYZ 1.51 Å, Structure of Ku80 von Willebrand domain complexed with APLF Ku Binding Motif
6TYW 1.7 Å, Structure of Ku80 von Willebrand domain S229A mutant complexed with APLF Ku Binding Motif
5W7X 2.0 Å, Crystal Structure of FHA domain of human APLF in complex with XRCC1 bisphospho peptide
5W7Y 2.1 Å, Crystal Structure of FHA domain of human APLF in complex with XRCC1 monophosphorylated…
6YN1 2.35 Å, Crystal structure of histone chaperone APLF acidic domain bound to the histone…
6TYT 2.4 Å, Structure of Ku80 von Willebrand domain S229A mutant complexed with APLF and XLF Ku…
6ERF 3.01 Å, Complex of APLF factor and Ku heterodimer bound to DNA
2KQB First PBZ domain of human APLF protein
2KQC Second PBZ domain of human APLF protein
2KQD First PBZ domain of human APLF protein in complex with ribofuranosyladenosine

Browse structure collections

About this viewer

MolViewer shows 2KUO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.