2KV4: EGF

EGF. Determined by solution NMR. Released 23 Feb 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 433
Mol. weight: 6.23 kDa
Released: 23 Feb 2011

Explore 2KV4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KV4 contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
β-strand	20	1	1
β-strand	31	1	1
β-strand	34	1	2
β-strand	37	1	2
α-helix	47-51	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Epidermal growth factor	A	protein	53	Homo sapiens	P01133 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KV4_1 Epidermal growth factor (chains A)
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Primary citation

The NMR solution structure of human epidermal growth factor (hEGF) at physiological pH and its interactions with suramin. Huang, H.W., Mohan, S.K., Yu, C. Biochem Biophys Res Commun (2010) 402:705-710. DOI 10.1016/j.bbrc.2010.10.089 · PubMed

Other PDB entries of the same protein (UniProt P01133 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NQL 2.8 Å, Structure of the extracellular domain of human epidermal growth factor (EGF) receptor in…
1JL9 3.0 Å, Crystal Structure of Human Epidermal Growth Factor
7SYD 3.1 Å, Cryo-EM structure of the extracellular module of the full-length EGFR bound to EGF…
1IVO 3.3 Å, Crystal Structure of the Complex of Human Epidermal Growth Factor and Receptor…
7SYE 3.3 Å, Cryo-EM structure of the extracellular module of the full-length EGFR bound to EGF.…
7SZ0 3.3 Å, Cryo-EM structure of the extracellular module of the full-length EGFR L834R bound to…
3NJP 3.3 Å, The Extracellular and Transmembrane Domain Interfaces in Epidermal Growth Factor…
8HGO 3.31 Å, The EGF-bound EGFR/HER2 ectodomain complex
7SZ1 3.4 Å, Cryo-EM structure of the extracellular module of the full-length EGFR L834R bound to…
8HGS 3.81 Å, The EGF-bound EGFR ectodomain homodimer
7OM4 6.05 Å, Nanobody EgB4 bound to the full extracellular EGFR-EGF complex
1P9J Solution structure and dynamics of the EGF/TGF-alpha chimera T1E

Browse structure collections

About this viewer

MolViewer shows 2KV4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.