2KXC: PDB entry 2KXC

1H, 13C, and 15N Chemical Shift Assignments for IRTKS-SH3 and EspFu-R47 complex. Determined by solution NMR. Released 17 Nov 2010.

Method: Solution NMR
Organisms: Homo sapiens, Escherichia coli
Chains: 2
Atoms: 663
Mol. weight: 12.86 kDa
Released: 17 Nov 2010

Explore 2KXC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KXC contains 2 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	343-346	4	1
β-strand	350	1	2
β-strand	358	1	1
β-strand	361	1	2
β-strand	366-369	4	1
β-strand	375	1	1
β-strand	378-383	6	1
β-strand	389-393	5	1
α-helix	394-396	3
β-strand	397-399	3	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	527-530	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1	A	protein	67	Homo sapiens	Q9UHR4 (AlphaFold model)
EspF-like protein	B	protein	48	Escherichia coli	P0DJ89 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KXC_1 Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 (chains A)
GSHMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSS
YTKLLEE

Sequence of entity 2 (B), FASTA

>2KXC_2 EspF-like protein (chains B)
GLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSRP

Primary citation

Recognition of tandem PxxP motifs as a unique Src homology 3-binding mode triggers pathogen-driven actin assembly. Aitio, O., Hellman, M., Kazlauskas, A. et al. Proc Natl Acad Sci U S A (2010) 107:21743-21748. DOI 10.1073/pnas.1010243107 · PubMed

Other PDB entries of the same protein (UniProt Q9UHR4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2LNH Enterohaemorrhagic E. coli (EHEC) exploits a tryptophan switch to hijack host F-actin…

Browse structure collections

About this viewer

MolViewer shows 2KXC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.