2LNH: Neural Wiskott-Aldrich syndrome protein

Enterohaemorrhagic E. coli (EHEC) exploits a tryptophan switch to hijack host F-actin assembly. Determined by solution NMR. Released 29 Aug 2012.

Method: Solution NMR
Organisms: Homo sapiens, Escherichia coli O157:H7
Chains: 3
Atoms: 1,411
Mol. weight: 20.12 kDa
Released: 29 Aug 2012

Explore 2LNH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LNH contains 9 α-helices and 11 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	12-13	2	1
β-strand	17-18	2	1
α-helix	20-22	3
α-helix	27-34	8
α-helix	38-41	4
α-helix	47-57	11
α-helix	60-64	5

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	73-76	4	2
β-strand	80	1	3
β-strand	88	1	2
β-strand	91	1	3
β-strand	96-99	4	2
β-strand	105	1	2
β-strand	108-113	6	2
β-strand	119-123	5	2
α-helix	124-126	3
β-strand	127-129	3	2

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	134-144	11
α-helix	152-154	3
α-helix	166-168	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neural Wiskott-Aldrich syndrome protein	A	protein	65	Homo sapiens	O00401 (AlphaFold model)
Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1	B	protein	67	Homo sapiens	Q9UHR4 (AlphaFold model)
Secreted effector protein EspF(U)	C	protein	48	Escherichia coli O157:H7	P0DJ89 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LNH_1 Neural Wiskott-Aldrich syndrome protein (chains A)
GSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGV
EAVKN

Sequence of entity 2 (B), FASTA

>2LNH_2 Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 (chains B)
GSHMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSS
YTKLLEE

Sequence of entity 3 (C), FASTA

>2LNH_3 Secreted effector protein EspF(U) (chains C)
GLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSRP

Primary citation

Enterohaemorrhagic Escherichia coli exploits a tryptophan switch to hijack host f-actin assembly. Aitio, O., Hellman, M., Skehan, B. et al. Structure (2012) 20:1692-1703. DOI 10.1016/j.str.2012.07.015 · PubMed

Other PDB entries of the same protein (UniProt O00401 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CC2 1.55 Å, Complex of human Tuba C-terminal SH3 domain with human N-WASP proline- rich peptide -…
4CC7 1.97 Å, Crystal structure of the sixth or C-terminal SH3 domain of human Tuba in complex with…
2FF3 2.0 Å, Crystal structure of Gelsolin domain 1:N-wasp V2 motif hybrid in complex with actin
9DLX 2.91 Å, Bovine Arp2/3 complex with N-WASP CA bound to Arp3 and Arp2-ArpC1
2VCP 3.2 Å, Crystal structure of N-Wasp VC domain in complex with skeletal actin
9R3Y Solution NMR structure of N-WASP GBD in complex with EspFu R5
9R4V Solution structure of N-WASP GBD in complex with EspF

Browse structure collections

About this viewer

MolViewer shows 2LNH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.