DAXX helical bundle (DHB) domain. Determined by solution NMR. Released 15 Dec 2010.
Explore 2KZS in 3D Show helices and sheets RCSB PDB PDBe
2KZS contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 60-77 | 18 | |
| α-helix | 84-93 | 10 | |
| β-strand | 95 | 1 | 1 |
| α-helix | 97-100 | 4 | |
| α-helix | 103-118 | 16 | |
| α-helix | 123-136 | 14 | |
| β-strand | 138 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Death-associated protein 6 | A | protein | 94 | Homo sapiens | Q9UER7 (AlphaFold model) |
>2KZS_1 Death-associated protein 6 (chains A) GSHMGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILS RVLSRARSRPAKLYVYINELCTVLKAHSAKKKLN
Structural Characterization of the DAXX N-Terminal Helical Bundle Domain and Its Complex with Rassf1C. Escobar-Cabrera, E., Lau, D.K., Giovinazzi, S. et al. Structure (2010) 18:1642-1653. DOI 10.1016/j.str.2010.09.016 · PubMed
Other PDB entries of the same protein (UniProt Q9UER7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2KZS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.