2KZU: Death-associated protein 6

DAXX helical bundle (DHB) domain / Rassf1C complex. Determined by solution NMR. Released 15 Dec 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 919
Mol. weight: 13.1 kDa
Released: 15 Dec 2010

Explore 2KZU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KZU contains 7 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	60-77	18
α-helix	84-93	10
α-helix	99-101	3
α-helix	103-118	16
α-helix	120-122	3
α-helix	123-137	15

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	29-32	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Death-associated protein 6	A	protein	94	Homo sapiens	Q9UER7 (AlphaFold model)
Ras association (RalGDS/AF-6) domain family 1	B	protein	18	Homo sapiens	Q9NS23 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KZU_1 Death-associated protein 6 (chains A)
GSHMGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILS
RVLSRARSRPAKLYVYINELCTVLKAHSAKKKLN

Sequence of entity 2 (B), FASTA

>2KZU_2 Ras association (RalGDS/AF-6) domain family 1 (chains B)
GSQEDSDSELEQYFTARW

Primary citation

Structural Characterization of the DAXX N-Terminal Helical Bundle Domain and Its Complex with Rassf1C. Escobar-Cabrera, E., Lau, D.K., Giovinazzi, S. et al. Structure (2010) 18:1642-1653. DOI 10.1016/j.str.2010.09.016 · PubMed

Other PDB entries of the same protein (UniProt Q9UER7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GRQ 1.58 Å, Crystal Structure of DHB domain of Daxx in complex with an ATRX peptide
4H9N 1.95 Å, Complex structure 1 of DAXX/H3.3(sub5)/H4
4H9Q 1.95 Å, Complex structure 4 of DAXX(E225A)/H3.3(sub5)/H4
4H9O 2.05 Å, Complex structure 2 of DAXX/H3.3(sub5,G90M)/H4
4H9R 2.2 Å, Complex structure 5 of DAXX(E225A)/H3.3(sub5,G90A)/H4
4H9P 2.2 Å, Complex structure 3 of DAXX/H3.3(sub5,G90A)/H4
5Y18 2.2 Å, Crystal structure of DAXX helical bundle domain in complex with ATRX
4H9S 2.6 Å, Complex structure 6 of DAXX/H3.3(sub7)/H4
4HGA 2.8 Å, Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX
5Y6O 3.1 Å, Crystal structure of DAXX N-terminal four-helix bundle domain (4HB) in complex with ATRX
5KDM 3.5 Å, Crystal structure of EBV tegument protein BNRF1 in complex with histone chaperone DAXX…
2KQS Phosphorylation of SUMO-interacting motif by CK2 enhances Daxx SUMO binding activity

Browse structure collections

About this viewer

MolViewer shows 2KZU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.