Solution structure of tandem SH2 domain from Spt6. Determined by solution NMR. Released 15 Jun 2011.
Explore 2L3T in 3D Show helices and sheets RCSB PDB PDBe
2L3T contains 5 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10 | 1 | 1 |
| α-helix | 15-24 | 10 | |
| β-strand | 30-34 | 5 | 1 |
| β-strand | 41-47 | 7 | 1 |
| β-strand | 53-61 | 9 | 1 |
| β-strand | 72-75 | 4 | 1 |
| β-strand | 78-80 | 3 | 1 |
| α-helix | 83-102 | 20 | |
| α-helix | 112-125 | 14 | |
| β-strand | 131-136 | 6 | 2 |
| β-strand | 144-149 | 6 | 2 |
| α-helix | 155-156 | 2 | |
| β-strand | 157-164 | 8 | 2 |
| β-strand | 167-170 | 4 | 2 |
| β-strand | 173-175 | 3 | 2 |
| α-helix | 178-194 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcription elongation factor SPT6 | A | protein | 199 | Saccharomyces cerevisiae | P23615 (AlphaFold model) |
>2L3T_1 Transcription elongation factor SPT6 (chains A) THRVINHPYYFPFNGRQAEDYLRSKERGEFVIRQSSRGDDHLVITWKLDKDLFQHIDIQE LEKENPLALGKVLIVDNQKYNDLDQIIVEYLQNKVRLLNEMTSSEKFKSGTKKDVVKFIE DYSRVNPNKSVYYFSLNHDNPGWFYLMFKINANSKLYTWNVKLTNTGYFLVNYNYPSVIQ LCNGFKTLLKSLEHHHHHH
Solution structure of the tandem SH2 domains from Spt6 and their binding to the phosphorylated RNA polymerase II C-terminal domain. Liu, J. To be published.
Other PDB entries of the same protein (UniProt P23615 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2L3T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.