2L5B: Activator of apoptosis harakiri

Name: PDB 2L5B: Solution structure of the transmembrane domain of Bcl-2 member Harakiri in micelles
Published: 2011-09-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Solution structure of the transmembrane domain of Bcl-2 member Harakiri in micelles. Determined by solution NMR. Released 14 Sept 2011.

Method: Solution NMR
Chains: 1
Atoms: 236
Mol. weight: 3.32 kDa
Released: 14 Sept 2011

Explore 2L5B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L5B contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-25	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Activator of apoptosis harakiri	A	protein	32		O00198 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L5B_1 Activator of apoptosis harakiri (chains A)
APGALPTYWPWLCAAAQVAALAAWLLGRRNLX

Primary citation

Intrinsic order and disorder in the bcl-2 member harakiri: insights into its proapoptotic activity. Barrera-Vilarmau, S., Obregon, P., de Alba, E. PLoS One (2011) 6:e21413-e21413. DOI 10.1371/journal.pone.0021413 · PubMed

Other PDB entries of the same protein (UniProt O00198 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9UGP 1.39 Å, Crystal structure of MCL-1 in complex with HRK BH3
7P0U 1.99 Å, ORF virus encoded Bcl-2 homolog ORFV125 in complex with Puma BH3 peptide
6XY4 2.05 Å, Structural insight into sheep-pox virus mediated inhibition of apoptosis
9LI8 2.32 Å, Crystal structure of Bcl-xL in complex with HRK BH3 peptide
9LGU 2.97 Å, Crystal structure of Bcl-xL in complex with stapled HRK peptide
2L58 Solution structure of the cytosolic fragment 22-53 of Bcl-2 member Harakiri

Browse structure collections

About this viewer

MolViewer shows 2L5B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.