9LI8: Bcl-xL

Crystal structure of Bcl-xL in complex with HRK BH3 peptide. Determined by X-ray diffraction at 2.32 Å resolution. Released 6 Aug 2025.

Method: X-ray diffraction
Resolution: 2.32 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,426
Mol. weight: 27.28 kDa
Released: 6 Aug 2025

Explore 9LI8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LI8 contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	4-19	16
α-helix	24-26	3
α-helix	83-104	22
α-helix	119-130	12
α-helix	137-156	20
α-helix	161-173	13
α-helix	174-178	5
α-helix	179-184	6
α-helix	187-195	9
α-helix	196-198	3
α-helix	199-203	5

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	28-49	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2-like protein 1	A	protein	217	Homo sapiens	Q07817 (AlphaFold model)
Activator of apoptosis harakiri	B	protein	25	Homo sapiens	O00198 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9LI8_1 Bcl-2-like protein 1 (chains A)
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERLEHHHHHH

Sequence of entity 2 (B), FASTA

>9LI8_2 Activator of apoptosis harakiri (chains B)
SSAAQLTAARLKALGDELHQRTMWR

Primary citation

Molecular mechanisms underlying HRK interaction with BCL-XL and BCL-2 reveal specificity determinants for BH3 mimetics. Wang, J., Guo, M., Dai, S. et al. iScience (2025) 28:113309-113309. DOI 10.1016/j.isci.2025.113309 · PubMed

Other PDB entries of the same protein (UniProt Q07817 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7JGW 1.3 Å, Crystal structure of BCL-XL in complex with COMPOUND 1620116, CRYSTAL FORM 1
3SP7 1.4 Å, Crystal Structure of Bcl-xL bound to BM903
7YAA 1.4 Å, Crystal structure analysis of cp3 bound BCLxl
7LH7 1.41 Å, Crystal structure of BCL-XL in complex with a benzothiazole-based inhibitor
9IGG 1.5 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
4QVF 1.53 Å, Crystal structure of Bcl-xL in complex with BIM BH3 domain
4A1U 1.54 Å, Crystal structure of alpha-beta-foldamer 2c in complex with Bcl-xL
6VWC 1.6 Å, Crystal structure of Bcl-xL in complex with tetrahydroisoquinoline-pyridine based…
6O0K 1.62 Å, crystal structure of BCL-2 with venetoclax
3SPF 1.7 Å, Crystal Structure of Bcl-xL bound to BM501
9I9E 1.7 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
9O14 1.73 Å, Crystal Structure of BCL-2 in complex with a stapled BAD BH3 peptide BAD SAHB 4.2

Browse structure collections

About this viewer

MolViewer shows 9LI8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.