2L6W: PDGFR beta-TM

PDGFR beta-TM. Determined by solution NMR. Released 30 May 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 624
Mol. weight: 8.84 kDa
Released: 30 May 2012

Explore 2L6W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L6W contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-32	27

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-33	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-type platelet-derived growth factor receptor	A, B	protein	39	Homo sapiens	P09619 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2L6W_1 Beta-type platelet-derived growth factor receptor (chains A, B)
GHSLPFKVVVISAILALVVLTIISLIILIMLWQKKPRYE

Primary citation

Hydrophobic matching controls the tilt and stability of the dimeric platelet-derived growth factor receptor (PDGFR) beta transmembrane segment. Muhle-Goll, C., Hoffmann, S., Afonin, S. et al. J Biol Chem (2012) 287:26178-26186. DOI 10.1074/jbc.M111.325555 · PubMed

Other PDB entries of the same protein (UniProt P09619 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1SHA 1.5 Å, Crystal structure of the phosphotyrosine recognition domain SH2 of V-src complexed with…
1H9O 1.79 Å, Phosphatidylinositol 3-kinase, P85-alpha subunit: C-terminal SH2 domain complexed with a…
3MJG 2.3 Å, The structure of a platelet derived growth factor receptor complex
11UE 2.32 Å, Structure of PDGFRb Kinase Domain Bound to JNJ-PDGFRBi-1
2IUI 2.4 Å, Crystal structure of the PI3-kinase p85 N-terminal SH2 domain in complex with PDGFR…
2PLD Nuclear magnetic resonance structure of an SH2 domain of phospholipase C-GAMMA1…
2PLE Nuclear magnetic resonance structure of an SH2 domain of phospholipase C-GAMMA1…

Browse structure collections

About this viewer

MolViewer shows 2L6W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.