NMR solution structure of GIP in micellular media. Determined by solution NMR. Released 19 Oct 2011.
Explore 2L70 in 3D Show helices and sheets RCSB PDB PDBe
2L70 contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-33 | 29 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Gastric inhibitory polypeptide | A | protein | 42 | Homo sapiens | P09681 (AlphaFold model) |
>2L70_1 Gastric inhibitory polypeptide (chains A) YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Conformational, receptor interaction and alanine scan studies of glucose-dependent insulinotropic polypeptide. Venneti, K.C., Malthouse, J.P.G., O'Harte, F.P.M. et al. Biochim Biophys Acta (2011) 1814:882-888. DOI 10.1016/j.bbapap.2011.04.002 · PubMed
Other PDB entries of the same protein (UniProt P09681 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2L70 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.