Determination of the three-dimensional structure of adrenomedullin, a first step towards the analysis of its interactions with receptors and small molecules. Determined by solution NMR. Released 28 Sept 2011.
Explore 2L7S in 3D Show helices and sheets RCSB PDB PDBe
2L7S contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 23-30 | 8 | |
| α-helix | 43-46 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Adrenomedullin | A | protein | 53 | Homo sapiens | P35318 (AlphaFold model) |
>2L7S_1 Adrenomedullin (chains A) YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYX
Structure of micelle-bound adrenomedullin: a first step toward the analysis of its interactions with receptors and small molecules. Perez-Castells, J., Martin-Santamaria, S., Nieto, L. et al. Biopolymers (2012) 97:45-53. DOI 10.1002/bip.21700 · PubMed
Other PDB entries of the same protein (UniProt P35318 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2L7S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.