4RWF: PDB entry 4RWF

Crystal structure of the CLR:RAMP2 extracellular domain heterodimer with bound adrenomedullin. Determined by X-ray diffraction at 1.76 Å resolution. Released 20 May 2015.

Method: X-ray diffraction
Resolution: 1.76 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 2
Atoms: 5,009
Mol. weight: 70.21 kDa
Released: 20 May 2015

Explore 4RWF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RWF contains 32 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 37 β-strands

Element	Residues	Length	Sheet
α-helix	4-5	2
β-strand	9-12	4	1
α-helix	19-33	15
β-strand	37-40	4	1
α-helix	45-54	10
β-strand	61-65	5	1
α-helix	66-68	3
α-helix	69-74	6
β-strand	78	1	2
α-helix	79-81	3
α-helix	85-88	4
β-strand	91	1	3
α-helix	93-98	6
β-strand	100-101	2	4
β-strand	104-105	2	4
β-strand	108-113	6	1
β-strand	116-120	5	5
β-strand	130	1	6
α-helix	134-142	9
β-strand	147-149	3	5
α-helix	156-165	10
β-strand	169	1	7
β-strand	173-174	2	8
β-strand	177-178	2	8
β-strand	184	1	7
α-helix	188-202	15
α-helix	212-220	9
β-strand	224-229	6	5
α-helix	231-233	3
α-helix	234-240	7
β-strand	244-247	4	5
α-helix	248-250	3
β-strand	251	1	6
β-strand	252	1	9
β-strand	255	1	9
α-helix	259	1
β-strand	260-261	2	10
β-strand	262-268	7	1
β-strand	269	1	2
α-helix	275-280	6
α-helix	281-286	6
α-helix	289-298	10
β-strand	303-304	2	1
β-strand	306	1	3
α-helix	307-313	7
α-helix	317-328	12
β-strand	330-331	2	10
α-helix	332-333	2
α-helix	338-353	16
α-helix	359-374	16
α-helix	1061-1076	16
α-helix	1077-1082	6
α-helix	1086-1106	21
α-helix	1114-1126	13
α-helix	2036-2054	19
β-strand	2064-2065	2	11
α-helix	2066-2067	2
β-strand	2068-2069	2	12
β-strand	2074-2075	2	12
β-strand	2078-2079	2	11
β-strand	2082-2087	6	13
α-helix	2088-2089	2
β-strand	2092	1	14
β-strand	2100-2105	6	13
β-strand	2111	1	13
β-strand	2113-2114	2	15
β-strand	2119-2120	2	15
β-strand	2123	1	13

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	39	1	14
α-helix	44-47	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose transporter subunit, Receptor activity-modifying protein 2, Calcitonin gene-related…	A	protein	591	Escherichia coli, Homo sapiens	O60895 (AlphaFold model), P0AEX9 (AlphaFold model), Q16602 (AlphaFold model)
Adrenomedullin	B	protein	29	Homo sapiens	P35318 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4RWF_1 Maltose transporter subunit, Receptor activity-modifying protein 2, Calcitonin gene-related peptide type 1 receptor fusion protein (chains A)
MAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPD
IIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYN
KDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDI
KDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTS
KVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKP
LGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVD
EALKDAQTNAAAEFGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCL
EHFAERFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDGSAGSAGSAEDSIQLGVTRN
KIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSE
KVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLHHHHHH

Sequence of entity 2 (B), FASTA

>4RWF_2 Adrenomedullin (chains B)
KLAHQIYQFTDKDKDNVAPRSKISPQGYX

Primary citation

Structural Basis for Receptor Activity-Modifying Protein-Dependent Selective Peptide Recognition by a G Protein-Coupled Receptor. Booe, J.M., Walker, C.S., Barwell, J. et al. Mol Cell (2015) 58:1-13. DOI 10.1016/j.molcel.2015.04.018 · PubMed

Other PDB entries of the same protein (UniProt O60895 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6V2E 1.83 Å, Crystal structure of the human CLR:RAMP2 extracellular domain heterodimer with bound…
3AQE 2.0 Å, Crystal structure of the extracellular domain of human RAMP2
2XVT 2.05 Å, Structure of the extracellular domain of human RAMP2
7TYX 2.55 Å, Human Amylin2 Receptor in complex with Gs and rat amylin peptide
3AQF 2.6 Å, Crystal structure of the human CRLR/RAMP2 extracellular complex
9BQ3 2.8 Å, Human Amylin2 Receptor in Complex with Gs and Cagrilintide
6UUN 3.0 Å, CryoEM Structure of the active Adrenomedullin 1 receptor G protein complex with…
7TYY 3.0 Å, Human Amylin2 Receptor in complex with Gs and salmon calcitonin peptide
7TYH 3.3 Å, Human Amylin2 Receptor in complex with Gs and human calcitonin peptide

Browse structure collections

About this viewer

MolViewer shows 4RWF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.