7VV0: Peptide from Pro-adrenomedullin

Cryo-EM structure of pseudoallergen receptor MRGPRX2 complex with PAMP-12, local. Determined by electron microscopy at 3.5 Å resolution. Released 1 Dec 2021.

Method: Electron microscopy
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,175
Mol. weight: 39.14 kDa
Ligands: CLR
Released: 1 Dec 2021

Explore 7VV0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VV0 contains 15 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain R: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	31-53	23
α-helix	54-58	5
α-helix	63-90	28
α-helix	91-95	5
α-helix	104-132	29
α-helix	134-139	6
α-helix	146-168	23
α-helix	177-212	36
α-helix	218-231	14
α-helix	232-236	5
α-helix	237-240	4
α-helix	241-246	6
α-helix	247-249	3
α-helix	257-273	17
α-helix	275-279	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
peptide from Pro-adrenomedullin	L	protein	12	Homo sapiens	P35318 (AlphaFold model)
Mas-related G-protein coupled receptor member X2	R	protein	330	Homo sapiens	Q96LB1 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>7VV0_1 peptide from Pro-adrenomedullin (chains L)
FRKKWNKWALSR

Sequence of entity 2 (R), FASTA

>7VV0_2 Mas-related G-protein coupled receptor member X2 (chains R)
MDPTTPAWGTESTTVNGNDQALLLLCGKETLIPVFLILFIALVGLVGNGFVLWLLGFRMR
RNAFSVYVLSLAGADFLFLCFQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSML
STVSTERCLSVLWPIWYRCRRPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDSGWC
QTFDFITAAWLIFLFMVLCGSSLALLVRILCGSRGLPLTRLYLTILLTVLVFLLCGLPFG
IQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSSANPIIYFFVGSFRKQWRLQQPILKLAL
QRALQDIAEVDHSEGCFRQGTPEMSRSSLV

Ligands and cofactors

ID	Name	Formula	Copies
CLR	Cholesterol	C27 H46 O	1

Primary citation

Structure, function and pharmacology of human itch receptor complexes. Yang, F., Guo, L., Li, Y. et al. Nature (2021) 600:164-169. DOI 10.1038/s41586-021-04077-y · PubMed

Other PDB entries of the same protein (UniProt P35318 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4RWF 1.76 Å, Crystal structure of the CLR:RAMP2 extracellular domain heterodimer with bound…
6V2E 1.83 Å, Crystal structure of the human CLR:RAMP2 extracellular domain heterodimer with bound…
6UUS 2.4 Å, CryoEM Structure of the active Adrenomedullin 2 receptor G protein complex with…
5V6Y 2.8 Å, Crystal structure of the human CLR:RAMP1 extracellular domain heterodimer with bound…
6UUN 3.0 Å, CryoEM Structure of the active Adrenomedullin 1 receptor G protein complex with…
2FLY Proadrenomedullin N-Terminal 20 Peptide
2L7S Determination of the three-dimensional structure of adrenomedullin, a first step towards…

Browse structure collections

About this viewer

MolViewer shows 7VV0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.