2LA6: RNA-binding protein FUS

Solution NMR Structure of RRM domain of RNA-binding protein FUS from homo sapiens, Northeast Structural Genomics Consortium Target HR6430A. Determined by solution NMR. Released 4 May 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 774
Mol. weight: 10.97 kDa
Released: 4 May 2011

Explore 2LA6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LA6 contains 4 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	15-19	5	1
α-helix	27-34	8
α-helix	39	1
β-strand	40	1	2
α-helix	41	1
β-strand	42-43	2	3
β-strand	48-49	2	3
β-strand	51-55	5	1
β-strand	62-69	8	1
β-strand	70	1	2
α-helix	73-83	11
β-strand	87	1	4
β-strand	92	1	4
β-strand	94-97	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA-binding protein FUS	A	protein	99	Homo sapiens	P35637 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LA6_1 RNA-binding protein FUS (chains A)
MGHHHHHHSHSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETG
KLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFAT

Primary citation

Northeast Structural Genomics Consortium Target HR6430A. Liu, G., Xiao, R., Janjua, H. et al. To be published.

Other PDB entries of the same protein (UniProt P35637 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KJ3 0.6 Å, 120kV MicroED structure of FUS (37-42) SYSGYS solved from merged datasets at 0.60 A
6KJ1 0.65 Å, 200kV MicroED structure of FUS (37-42) SYSGYS solved from merged datasets at 0.65 A
6KJ4 0.65 Å, 120kV MicroED structure of FUS (37-42) SYSGYS solved from single crystal at 0.65 A
6KJ2 0.67 Å, 200kV MicroED structure of FUS (37-42) SYSGYS solved from single crystal at 0.67 A
5XSG 0.73 Å, Ultrahigh resolution structure of FUS (37-42) SYSGYS determined by MicroED
6BWZ 1.1 Å, SYSGYS from low-complexity domain of FUS, residues 37-42
6BXV 1.1 Å, SYSSYGQS from low-complexity domain of FUS, residues 54-61
6BZP 1.1 Å, STGGYG from low-complexity domain of FUS, residues 77-82
5XRR 1.5 Å, Crystal structure of FUS (54-59) SYSSYG
4FDD 2.3 Å, Crystal structure of KAP beta2-PY-NLS
6XFM 2.62 Å, Molecular structure of the core of amyloid-like fibrils formed by residues 111-214 of FUS
7CYL 2.7 Å, Crystal structure of Karyopherin-beta2 in complex with FUS PY-NLS(P525L)

Browse structure collections

About this viewer

MolViewer shows 2LA6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.