2LAG: Interferon alpha/beta receptor 2

Structure of the 44 kDa complex of interferon-alpha2 with the extracellular part of IFNAR2 obtained by 2D-double difference NOESY. Determined by solution NMR. Released 17 Aug 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 3,059
Mol. weight: 43.59 kDa
Released: 17 Aug 2011

Explore 2LAG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LAG contains 12 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	10-20	11
α-helix	26-29	4
α-helix	41-44	4
α-helix	53-67	15
α-helix	70-75	6
α-helix	78-100	23
α-helix	111-132	22
α-helix	137-152	16
α-helix	156-158	3

Chain B: 3 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	5-6	2
β-strand	13-18	6	1
β-strand	23-28	6	1
β-strand	38-44	7	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	61	1	2
β-strand	65-67	3	1
β-strand	78-87	10	2
β-strand	90-100	11	2
β-strand	107	1	1
β-strand	112-116	5	3
β-strand	121-126	6	3
α-helix	132-134	3
β-strand	140-147	8	4
β-strand	150-154	5	4
β-strand	165-170	6	3
β-strand	178-186	9	4
β-strand	199-202	4	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon alpha/beta receptor 2	B	protein	212	Homo sapiens	P48551 (AlphaFold model)
Interferon alpha-2	A	protein	165	Homo sapiens	P01563 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>2LAG_1 Interferon alpha/beta receptor 2 (chains B)
SYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLYTIMSKPEDLKVVKNCAN
TTRSFCDLTDEWRSTHEAYVTVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFEIVGFTNH
INVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKLIPNTNYC
VSVYLEHSDEQAVIKSPLKCTLLPPGQESEFS

Sequence of entity 2 (A), FASTA

>2LAG_2 Interferon alpha-2 (chains A)
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVR
KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Primary citation

Observation of Intermolecular Interactions in Large Protein Complexes by 2D-Double Difference Nuclear Overhauser Enhancement Spectroscopy: Application to the 44 kDa Interferon-Receptor Complex. Nudelman, I., Akabayov, S.R., Scherf, T. et al. J Am Chem Soc (2011) 133:14755-14764. DOI 10.1021/ja205480v · PubMed

Other PDB entries of the same protein (UniProt P48551 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3S9D 2.0 Å, binary complex between IFNa2 and IFNAR2
3S8W 2.6 Å, D2 domain of human IFNAR2
3SE4 3.5 Å, human IFNw-IFNAR ternary complex
3SE3 4.0 Å, human IFNa2-IFNAR ternary complex
1N6U NMR structure of the interferon-binding ectodomain of the human interferon receptor
1N6V Average structure of the interferon-binding ectodomain of the human type I interferon…
2HYM NMR based Docking Model of the Complex between the Human Type I Interferon Receptor and…
2KZ1 Inter-molecular interactions in a 44 kDa interferon-receptor complex detected by…

Browse structure collections

About this viewer

MolViewer shows 2LAG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.