Third WW domain of human Nedd4L in complex with doubly phosphorylated human smad3 derived peptide. Determined by solution NMR. Released 6 Jul 2011.
Explore 2LAJ in 3D Show helices and sheets RCSB PDB PDBe
2LAJ contains 1 α-helix and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 483-488 | 6 | 1 |
| β-strand | 492-497 | 6 | 1 |
| β-strand | 502-504 | 3 | 1 |
| α-helix | 508-514 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase NEDD4-like | A | protein | 44 | Homo sapiens | Q96PU5 (AlphaFold model) |
| Mothers against decapentaplegic homolog 3 | B | protein | 10 | Homo sapiens | P84022 (AlphaFold model) |
>2LAJ_1 E3 ubiquitin-protein ligase NEDD4-like (chains A) GAMEQSFLPPGWEMRIAPNGRPFFYDHNTKTTTWEDPRLKFPVH
>2LAJ_2 Mothers against decapentaplegic homolog 3 (chains B) AGSPNLSPNP
A Smad action turnover switch operated by WW domain readers of a phosphoserine code. Aragon, E., Goerner, N., Zaromytidou, A.I. et al. Genes Dev (2011) 25:1275-1288. DOI 10.1101/gad.2060811 · PubMed
Other PDB entries of the same protein (UniProt Q96PU5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2LAJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.