2LB3: WW domain of PIN1

Structure of the WW domain of PIN1 in complex with a human phosphorylated Smad3 derived peptide. Determined by solution NMR. Released 6 Jul 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 360
Mol. weight: 5.12 kDa
Released: 6 Jul 2011

Explore 2LB3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LB3 contains 0 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	17-20	4	1
β-strand	25-30	6	1
β-strand	35-37	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1	A	protein	36	Homo sapiens	Q13526 (AlphaFold model)
Mothers against decapentaplegic homolog 2	B	protein	8	Homo sapiens	Q15796 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LB3_1 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (chains A)
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNS

Sequence of entity 2 (B), FASTA

>2LB3_2 Mothers against decapentaplegic homolog 2 (chains B)
IPETPPPG

Primary citation

A Smad action turnover switch operated by WW domain readers of a phosphoserine code. Aragon, E., Goerner, N., Zaromytidou, A.I. et al. Genes Dev (2011) 25:1275-1288. DOI 10.1101/gad.2060811 · PubMed

Other PDB entries of the same protein (UniProt Q13526 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7AZ2 1.08 Å, 14-3-3 sigma with Pin1 binding site pS72 and covalently bound LvD1014
7AZ1 1.15 Å, 14-3-3 sigma with Pin1 binding site pS72 and covalently bound LvD1013
3I6C 1.3 Å, Structure-Based Design of Novel PIN1 Inhibitors (II)
4TNS 1.33 Å, Structure of Pin1 PPIase domain bound with all-trans retinoic acid
1PIN 1.35 Å, PIN1 peptidyl-prolyl cis-trans isomerase from homo sapiens
3TC5 1.4 Å, Selective targeting of disease-relevant protein binding domains by O-phosphorylated…
7AXN 1.4 Å, 14-3-3 sigma in complex with Pin1 binding site pS72 and covalently bound TCF521-026
7BG3 1.4 Å, 14-3-3 sigma with Pin1 binding site pS72 and covalently bound PC2046
6VAJ 1.42 Å, Crystal Structure Analysis of human PIN1
9KFZ 1.43 Å, Crystal structure of the PIN1 and fragment 59 complex
2ITK 1.45 Å, human Pin1 bound to D-PEPTIDE
2ZQT 1.46 Å, Crystal structure of a mutant PIN1 PEPTIDYL-PROLYL CIS-TRANS ISOMERASE

Browse structure collections

About this viewer

MolViewer shows 2LB3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.