2LCW: FUS/TLS RRM domain

solution structure of FUS/TLS RRM domain. Determined by solution NMR. Released 6 Jun 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 827
Mol. weight: 12.82 kDa
Released: 6 Jun 2012

Explore 2LCW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LCW contains 2 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	287-290	4	1
α-helix	298-304	7
β-strand	311	1	2
β-strand	313	1	3
β-strand	320	1	3
β-strand	322-326	5	1
β-strand	333-339	7	1
β-strand	341	1	2
α-helix	344-353	10
β-strand	358-360	3	4
β-strand	362-363	2	4
β-strand	365-367	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA-binding protein FUS	A	protein	116	Homo sapiens	P35637 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LCW_1 RNA-binding protein FUS (chains A)
EQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEA
TVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGLEHHHHHH

Primary citation

TLS-RRM is a promiscuous nucleic acid binding domain. Liu, X., Ren, J., Niu, C. et al. To be published.

Other PDB entries of the same protein (UniProt P35637 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KJ3 0.6 Å, 120kV MicroED structure of FUS (37-42) SYSGYS solved from merged datasets at 0.60 A
6KJ1 0.65 Å, 200kV MicroED structure of FUS (37-42) SYSGYS solved from merged datasets at 0.65 A
6KJ4 0.65 Å, 120kV MicroED structure of FUS (37-42) SYSGYS solved from single crystal at 0.65 A
6KJ2 0.67 Å, 200kV MicroED structure of FUS (37-42) SYSGYS solved from single crystal at 0.67 A
5XSG 0.73 Å, Ultrahigh resolution structure of FUS (37-42) SYSGYS determined by MicroED
6BWZ 1.1 Å, SYSGYS from low-complexity domain of FUS, residues 37-42
6BXV 1.1 Å, SYSSYGQS from low-complexity domain of FUS, residues 54-61
6BZP 1.1 Å, STGGYG from low-complexity domain of FUS, residues 77-82
5XRR 1.5 Å, Crystal structure of FUS (54-59) SYSSYG
4FDD 2.3 Å, Crystal structure of KAP beta2-PY-NLS
6XFM 2.62 Å, Molecular structure of the core of amyloid-like fibrils formed by residues 111-214 of FUS
7CYL 2.7 Å, Crystal structure of Karyopherin-beta2 in complex with FUS PY-NLS(P525L)

Browse structure collections

About this viewer

MolViewer shows 2LCW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.