Solution structure of the human AKAP13 PH domain and stabilizing DH helix. Determined by solution NMR. Released 3 Aug 2011.
Explore 2LG1 in 3D Show helices and sheets RCSB PDB PDBe
2LG1 contains 4 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 25-30 | 6 | |
| α-helix | 31-45 | 15 | |
| β-strand | 53-54 | 2 | 1 |
| β-strand | 60-61 | 2 | 1 |
| α-helix | 63-66 | 4 | |
| β-strand | 71-80 | 10 | 2 |
| β-strand | 86-94 | 9 | 2 |
| β-strand | 97-99 | 3 | 2 |
| β-strand | 102-104 | 3 | 3 |
| β-strand | 107-109 | 3 | 3 |
| β-strand | 119-121 | 3 | 2 |
| β-strand | 126-128 | 3 | 2 |
| β-strand | 136-140 | 5 | 2 |
| β-strand | 150-153 | 4 | 2 |
| α-helix | 157-177 | 21 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| A-kinase anchor protein 13 | A | protein | 185 | Homo sapiens | Q12802 (AlphaFold model) |
>2LG1_1 A-kinase anchor protein 13 (chains A) SMTKDNEVEQEDLAQSLSLVKDVIGAVDSKVASYEKKVRLNEIYTKTDSKSIMRMKSGQM FAKEDLKRKKLVRDGSVFLKNAAGRLKEVQAVLLTDILVFLQEKDQKYIFASLDQKSTVI SLKKLIVREVAHEEKGLFLISMGMTDPEMVEVHASSKEERNSWIQIIQDTINTLNRDEDE GIPSE
Structural Insights into the Activation of the RhoA GTPase by the Lbc Oncoprotein. Lenoir, M., Sugawara, M., Kaur, J. et al. J Biol Chem (2014) 3:215-218. DOI 10.1074/jbc.M114.561787 · PubMed
Other PDB entries of the same protein (UniProt Q12802 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2LG1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.