4D0O: AKAP13 (AKAP-Lbc) DH domain

AKAP13 (AKAP-Lbc) DH domain. Determined by X-ray diffraction at 2.75 Å resolution. Released 21 May 2014.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 3,692
Mol. weight: 57.52 kDa
Released: 21 May 2014

Explore 4D0O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4D0O contains 26 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1970-1984	15
α-helix	1987-1990	4
α-helix	1994-2019	26
α-helix	2020-2025	6
α-helix	2026-2031	6
α-helix	2036-2042	7
α-helix	2046-2065	20
β-strand	2068	1	1
β-strand	2076	1	1
α-helix	2082-2088	7
α-helix	2091-2121	31
α-helix	2123-2134	12
α-helix	2143-2153	11
α-helix	2157-2167	11
α-helix	2172-2203	32

Chain B: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1970-1984	15
α-helix	1987-1990	4
α-helix	1994-2019	26
α-helix	2020-2025	6
α-helix	2026-2031	6
α-helix	2036-2042	7
α-helix	2046-2065	20
β-strand	2068	1	2
β-strand	2076	1	2
α-helix	2082-2088	7
α-helix	2091-2121	31
α-helix	2123-2134	12
α-helix	2143-2153	11
α-helix	2157-2167	11
α-helix	2172-2206	35

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
A-kinase anchor protein 13	A, B	protein	244	HOMO SAPIENS	Q12802 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4D0O_1 A-KINASE ANCHOR PROTEIN 13 (chains A, B)
ENLYFQSMEAESWSRIIDSKFLKQQKKDVVKRQEVIYELMQTEFHHVRTLKIMSGVYSQG
MMADLLFEQQMVEKLFPCLDELISIHSQFFQRILERKKESLVDKSEKNFLIKRIGDVLVN
QFSGENAERLKKTYGKFCGQHNQSVNYFKDLYAKDKRFQAFVKKKMSSSVVRRLGIPECI
LLVTQRITKYPVLFQRILQCTKDNEVEQEDLAQSLSLVKDVIGAVDSKVASYEKKVRLNE
IYTK

Primary citation

The Crystal Structure of the Rhoa : Akap-Lbc Dh-Ph Domain Complex. Abdul Azeez, K.R., Knapp, S., Fernandes, J.M.P. et al. Biochem J (2014) 464:231. DOI 10.1042/BJ20140606 · PubMed

Other PDB entries of the same protein (UniProt Q12802 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BCA 2.0 Å, A Complex between PH Domain of LbcRhoGEF (AKAP-Lbc) and Activated RhoA Bound to a GTP…
4D0N 2.1 Å, AKAP13 (AKAP-Lbc) RhoGEF domain in complex with RhoA
2DRN Docking and dimerization domain (D/D) of the Type II-alpha regulatory subunity of…
2LG1 Solution structure of the human AKAP13 PH domain and stabilizing DH helix

Browse structure collections

About this viewer

MolViewer shows 4D0O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.