2LJV: Rhodostomin G50L mutant

Solution structure of Rhodostomin G50L mutant. Determined by solution NMR. Released 3 Oct 2012.

Method: Solution NMR
Organism: Calloselasma rhodostoma
Chains: 1
Atoms: 504
Mol. weight: 7.4 kDa
Released: 3 Oct 2012

Explore 2LJV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LJV contains 1 α-helix and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	14-15	2	1
β-strand	20-21	2	1
β-strand	33-34	2	2
β-strand	37-38	2	2
α-helix	39-40	2
β-strand	43-46	4	3
β-strand	55-57	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disintegrin rhodostomin	A	protein	68	Calloselasma rhodostoma	P30403 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LJV_1 Disintegrin rhodostomin (chains A)
GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIPRLDMPDDRCTGQ
SADCPRYH

Primary citation

Design of Integrin AlphaVbeta3-Specific Disintegrin for Cancer Therapy. Shiu, J., Chen, C., Chen, Y. et al. To be published.

Other PDB entries of the same protein (UniProt P30403 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4R5R 0.96 Å, Crystal structure of Rhodostomin KKKRT mutant
3UCI 1.35 Å, Crystal structure of Rhodostomin ARLDDL mutant
7X4V 1.38 Å, Crystal structure of Rhodostomin ARGDDP mutant
7X4Z 1.48 Å, Crystal structure of Rhodostomin ARGDWP mutant
4RQG 1.66 Å, Crystal structure of Rhodostomin
7X4S 1.8 Å, Crystal structure of Rhodostomin ARGDMP mutant
26QZ 1.8 Å, Crystal structure of Rhodostomin ARGDP mutant
4R5U 1.81 Å, Crystal structure of Rhodostomin R46E mutant
9IUJ 2.78 Å, Integrin alpha-v beta-3 in complex with rhodostomin
1N4Y Refined structure of kistrin
1Q7I Structural Analysis of Integrin alpha IIb beta 3- Disintegrin with the AKGDWN Motif
1Q7J Structural Analysis of Integrin alpha IIb beta 3- Disintegrin with the AKGDWN Motif

Browse structure collections

About this viewer

MolViewer shows 2LJV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.