2LKZ: Second RRM domain of RBM5

Solution structure of the second RRM domain of RBM5. Determined by solution NMR. Released 8 Aug 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 738
Mol. weight: 10.52 kDa
Released: 8 Aug 2012

Explore 2LKZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LKZ contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	1
α-helix	23-29	7
α-helix	38-40	3
β-strand	41-42	2	1
β-strand	55-59	5	1
α-helix	64-74	11
β-strand	80-82	3	2
β-strand	85-87	3	2
β-strand	88-91	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA-binding protein 5	A	protein	95	Homo sapiens	P52756 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LKZ_1 RNA-binding protein 5 (chains A)
MGHHHHHHMDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQL
SSAMDASQLLQILQSLHPPLKIDGKTIGVDFAKSA

Primary citation

Solution structure of the second RRM domain of RBM5 and its unusual binding characters for different RNA targets. Song, Z., Wu, P., Ji, P. et al. Biochemistry (2012). DOI 10.1021/bi300539t · PubMed

Other PDB entries of the same protein (UniProt P52756 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PCV 2.42 Å, Crystal structure of RBM5 RRM1-zinc finger
9ZE2 3.26 Å, Cryo-EM structure of the endogenous U2/branchpoint spliceosomal complex (core)
9ZE0 3.43 Å, Cryo-EM structure of the endogenous U2/branchpoint spliceosomal complex (Proximal DHX15…
7PDV 3.49 Å, Crystal structure of RBM5 RRM1-zinc finger in complex with RNA
9ZEC 3.61 Å, Cryo-EM structure of the endogenous U2/branchpoint spliceosomal complex (SF3A state 1)
9ZE3 3.93 Å, Cryo-EM structure of the endogenous U2/branchpoint spliceosomal complex (Distal DHX15…
9ZED 3.94 Å, Cryo-EM structure of the endogenous U2/branchpoint spliceosomal complex (SF3A state 2)
2LK0 Solution structure and binding studies of the RanBP2-type zinc finger of RBM5
2LK1 Solution structure and binding studies of the RanBP2-type zinc finger of RBM5
5MF9 Solution structure of the RBM5 OCRE domain in complex with polyproline SmN peptide.
5MFY RBM5 OCRE domain

Browse structure collections

About this viewer

MolViewer shows 2LKZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.