5MF9: RBM5 OCRE domain

Name: PDB 5MF9: Solution structure of the RBM5 OCRE domain in complex with polyproline SmN peptide.
Published: 2016-12-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: splicing

Solution structure of the RBM5 OCRE domain in complex with polyproline SmN peptide. Determined by solution NMR. Released 7 Dec 2016.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 607
Mol. weight: 8.57 kDa
Released: 7 Dec 2016

Explore 5MF9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5MF9 contains 2 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
α-helix	15	1
β-strand	16-18	3	1
β-strand	23-26	4	1
β-strand	31-33	3	1
β-strand	40-42	3	1
β-strand	47-51	5	1
β-strand	58-60	3	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	103-104	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA-binding protein 5	A	protein	64	Homo sapiens	P52756 (AlphaFold model)
Survival motor neuron protein	B	protein	11	Homo sapiens	Q16637 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5MF9_1 RNA-binding protein 5 (chains A)
GAMGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVP
AAES

Sequence of entity 2 (B), FASTA

>5MF9_2 Survival motor neuron protein (chains B)
GMRPPPPGIRG

Primary citation

Structural basis for the recognition ofspliceosomal SmN B B proteins by theRBM5 OCRE domain in splicing regulation. Mourao, A., Bonnal, S., Komal, S. et al. Elife (2016) 5:1-25. DOI 10.7554/eLife.14707 · PubMed

Other PDB entries of the same protein (UniProt P52756 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PCV 2.42 Å, Crystal structure of RBM5 RRM1-zinc finger
9ZE2 3.26 Å, Cryo-EM structure of the endogenous U2/branchpoint spliceosomal complex (core)
9ZE0 3.43 Å, Cryo-EM structure of the endogenous U2/branchpoint spliceosomal complex (Proximal DHX15…
7PDV 3.49 Å, Crystal structure of RBM5 RRM1-zinc finger in complex with RNA
9ZEC 3.61 Å, Cryo-EM structure of the endogenous U2/branchpoint spliceosomal complex (SF3A state 1)
9ZE3 3.93 Å, Cryo-EM structure of the endogenous U2/branchpoint spliceosomal complex (Distal DHX15…
9ZED 3.94 Å, Cryo-EM structure of the endogenous U2/branchpoint spliceosomal complex (SF3A state 2)
2LK0 Solution structure and binding studies of the RanBP2-type zinc finger of RBM5
2LK1 Solution structure and binding studies of the RanBP2-type zinc finger of RBM5
2LKZ Solution structure of the second RRM domain of RBM5
5MFY RBM5 OCRE domain

Browse structure collections

About this viewer

MolViewer shows 5MF9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.