2LNK: Ca-bound S100A4

Solution structure of Ca-bound S100A4 in complex with non-muscle myosin IIA. Determined by solution NMR. Released 25 Apr 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 3
Atoms: 1,952
Mol. weight: 30.81 kDa
Released: 25 Apr 2012

Explore 2LNK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LNK contains 13 α-helices and 4 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-18	15
β-strand	29	1	1
α-helix	31-41	11
α-helix	43-46	4
α-helix	54-62	9
β-strand	70	1	1
α-helix	72-88	17

Chain B: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-18	15
β-strand	29-30	2	2
α-helix	31-41	11
α-helix	44-46	3
α-helix	52-61	10
β-strand	69-70	2	2
α-helix	72-86	15
α-helix	87-92	6

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1899-1903	5
α-helix	1905-1921	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin heavy chain, non-muscle IIa	C	protein	39	Homo sapiens	P35579 (AlphaFold model)
Protein S100-A4	A, B	protein	113	Homo sapiens	P26447 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>2LNK_1 Myosin heavy chain, non-muscle IIa (chains C)
QRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMA

Sequence of entity 2 (A, B), FASTA

>2LNK_2 Protein S100-A4 (chains A, B)
MRGSHHHHHHGSMACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGK
RTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Primary citation

Asymmetric Mode of Ca(2+)-S100A4 Interaction with Nonmuscle Myosin IIA Generates Nanomolar Affinity Required for Filament Remodeling. Elliott, P.R., Irvine, A.F., Jung, H.S. et al. Structure (2012) 20:654-666. DOI 10.1016/j.str.2012.02.002 · PubMed

Other PDB entries of the same protein (UniProt P35579 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CFQ 1.37 Å, Ca-bound truncated (delta13C) and C3S, C81S and C86S mutated S100A4 complexed with…
4CFR 1.4 Å, Ca-bound S100A4 C3S, C81S, C86S and F45W mutant complexed with non- muscle myosin IIA
4ETO 1.54 Å, Structure of S100A4 in complex with non-muscle myosin-IIA peptide
3ZWH 1.94 Å, Ca2+-bound S100A4 C3S, C81S, C86S and F45W mutant complexed with myosin IIA
9IHL 2.02 Å, Crystal Structure of the Human Nonmuscle Myosin 2A Motor Domain
9SYU 2.98 Å, shutdown state non-muscle myosin 2A heads region
9SZR 6.3 Å, shutdown state non-muscle myosin 2A heads region

Browse structure collections

About this viewer

MolViewer shows 2LNK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.