Crystal Structure of the Human Nonmuscle Myosin 2A Motor Domain. Determined by X-ray diffraction at 2.02 Å resolution. Released 24 Sept 2025.
Explore 9IHL in 3D Show helices and sheets RCSB PDB PDBe
9IHL contains 43 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 25-28 | 4 | |
| β-strand | 31-36 | 6 | 1 |
| β-strand | 40-50 | 11 | 1 |
| β-strand | 53-58 | 6 | 1 |
| β-strand | 64-68 | 5 | 1 |
| α-helix | 69-71 | 3 | |
| β-strand | 73-74 | 2 | 1 |
| α-helix | 78-80 | 3 | |
| β-strand | 85 | 1 | 2 |
| α-helix | 86-88 | 3 | |
| α-helix | 94-105 | 12 | |
| β-strand | 111-114 | 4 | 2 |
| β-strand | 117-121 | 5 | 2 |
| α-helix | 132-138 | 7 | |
| α-helix | 143-145 | 3 | |
| α-helix | 150-164 | 15 | |
| β-strand | 168-173 | 6 | 2 |
| α-helix | 179-194 | 16 | |
| α-helix | 206-222 | 17 | |
| β-strand | 223-224 | 2 | 3 |
| β-strand | 232-233 | 2 | 3 |
| β-strand | 236-243 | 8 | 2 |
| β-strand | 249-257 | 9 | 2 |
| α-helix | 261-264 | 4 | |
| β-strand | 274 | 1 | 3 |
| α-helix | 275-283 | 9 | |
| α-helix | 286-291 | 6 | |
| α-helix | 297-299 | 3 | |
| α-helix | 308-310 | 3 | |
| α-helix | 315-329 | 15 | |
| α-helix | 333-349 | 17 | |
| β-strand | 355-356 | 2 | 4 |
| β-strand | 363-364 | 2 | 4 |
| α-helix | 369-378 | 10 | |
| α-helix | 382-390 | 9 | |
| β-strand | 393-396 | 4 | 5 |
| β-strand | 399-402 | 4 | 5 |
| α-helix | 407-437 | 31 | |
| β-strand | 446-452 | 7 | 2 |
| α-helix | 464-494 | 31 | |
| α-helix | 504-507 | 4 | |
| α-helix | 509-516 | 8 | |
| α-helix | 524-532 | 9 | |
| α-helix | 539-550 | 12 | |
| β-strand | 556-557 | 2 | 6 |
| β-strand | 568-572 | 5 | 6 |
| β-strand | 575-579 | 5 | 6 |
| α-helix | 584-588 | 5 | |
| β-strand | 589 | 1 | 7 |
| α-helix | 594-601 | 8 | |
| α-helix | 606-611 | 6 | |
| β-strand | 645 | 1 | 7 |
| α-helix | 646-662 | 17 | |
| β-strand | 665-672 | 8 | 2 |
| α-helix | 685-694 | 10 | |
| α-helix | 697-706 | 10 | |
| β-strand | 710-713 | 4 | 8 |
| α-helix | 714-721 | 8 | |
| α-helix | 722-724 | 3 | |
| α-helix | 736-746 | 11 | |
| β-strand | 754-756 | 3 | 8 |
| β-strand | 760-763 | 4 | 8 |
| α-helix | 767-802 | 36 | |
| α-helix | 811-823 | 13 | |
| α-helix | 824-828 | 5 | |
| α-helix | 829-848 | 20 | |
| α-helix | 866-922 | 57 | |
| α-helix | 931-968 | 38 | |
| α-helix | 974-984 | 11 | |
| α-helix | 985-989 | 5 | |
| α-helix | 990-1015 | 26 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myosin-9,Alpha-actinin A | A | protein | 1025 | Homo sapiens, Dictyostelium discoideum | P05095 (AlphaFold model), P35579 (AlphaFold model) |
>9IHL_1 Myosin-9,Alpha-actinin A (chains A) MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK SFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERASEQT KSDYLKRANELVQWINDKQASLESRDFGDSIESVQSFMNAHKEYKKTEKPPKGQEVSELE AIYNSLQTKLRLIKREPFVAPAGLTPNEIDSTWSALEKAEQEHAEALRIELKRQKKIAVL LQKYNRILKKLENWATTKSVYLGSNETGDSITAVQAKLKNLEAFDGECQSLEGQSNSDLL SILAQLTELNYNGVPELTERKDTFFAQQWTGVKSSAETYKNTLLAELERLQKIEDALHHH HHHHH
Structure of the human nonmuscle myosin 2A motor domain: Insights into isoform-specific mechanochemistry. Heiringhoff, R.S., Greve, J.N., Zahn, M. et al. J Biol Chem (2025) 301:110691-110691. DOI 10.1016/j.jbc.2025.110691 · PubMed
Other PDB entries of the same protein (UniProt P05095 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9IHL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.