2LO1: DnaJ homolog subfamily A member 1

NMR structure of the protein BC008182, a DNAJ-like domain from Homo sapiens. Determined by solution NMR. Released 15 Feb 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 578
Mol. weight: 8.22 kDa
Released: 15 Feb 2012

Explore 2LO1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LO1 contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	8-11	4
α-helix	20-34	15
α-helix	36-38	3
α-helix	43-55	13
α-helix	59-65	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DnaJ homolog subfamily A member 1	A	protein	71	Homo sapiens	P31689 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LO1_1 DnaJ homolog subfamily A member 1 (chains A)
GMVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAK
KRELYDKGGEQ

Primary citation

NMR structure of the protein BC008182, DNAJ homolog from Homo sapiens. Dutta, S.K., Serrano, P., Geralt, M. et al. To be published.

Other PDB entries of the same protein (UniProt P31689 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6E8M 1.61 Å, Legionella Longbeachae LeSH (Llo2327) bound to the human DnaJ-A1 pTyr381 peptide
2M6Y The solution structure of the J-domain of human DnaJA1
8E2O Leveraging the Structure of DNAJA1 to Discover Novel Pancreatic Cancer Therapies

Browse structure collections

About this viewer

MolViewer shows 2LO1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.