2LRK: Phosphocarrier protein HPr

Name: PDB 2LRK: Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose
Published: 2012-05-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose. Determined by solution NMR. Released 16 May 2012.

Method: Solution NMR
Organism: Escherichia coli
Chains: 4
Atoms: 2,986
Mol. weight: 42.87 kDa
Released: 16 May 2012

Explore 2LRK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LRK contains 12 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	3-30	28
α-helix	34-60	27
α-helix	72-100	29

Chain D: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	302-307	6	1
α-helix	316-327	12
β-strand	332-337	6	1
β-strand	340-343	4	1
α-helix	347-350	4
β-strand	360-366	7	1
α-helix	370-383	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphocarrier protein HPr	D	protein	85	Escherichia coli	P0AA04 (AlphaFold model)
N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIA component	A, B, C	protein	103	Escherichia coli	P69791 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>2LRK_1 Phosphocarrier protein HPr (chains D)
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTV
VTISAEGEDEQKAVEHLVKLMAELE

Sequence of entity 2 (A, B, C), FASTA

>2LRK_2 N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIA component (chains A, B, C)
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIE
GDAGEGKMKVSLVLVEAQLHLMTSMLARELITELIELHEKLKA

Primary citation

Solution Structure of the IIAChitobiose-HPr Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System. Jung, Y.S., Cai, M., Clore, G.M. J Biol Chem (2012) 287:23819-23829. DOI 10.1074/jbc.M112.371492 · PubMed

Other PDB entries of the same protein (UniProt P0AA04 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CCD 1.0 Å, 1.0 A Structure of Post-Succinimide His15Asp HPr
1OPD 1.5 Å, Histidine-containing protein (HPR), mutant with ser 46 replaced by asp (S46D)
1CM3 1.6 Å, HIS15ASP hpr from E. Coli
1CM2 1.8 Å, Structure of HIS15ASP hpr after hydrolysis of ringed species.
1POH 2.0 Å, The 2.0 Å resolution structure of escherichia coli histidine-containing phosphocarrier…
9S8K 2.06 Å, Structure of glycogen phosphorylase - tetrameric form - in complex with HPr from…
4XWJ 2.1 Å, Histidine-containing phosphocarrier protein (HPr) and antisigma factor Rsd complex
2JEL 2.5 Å, JEL42 fab/hpr complex
5YA1 2.7 Å, crystal structure of LsrK-HPr complex with ATP
5YA2 2.7 Å, Crystal structure of LsrK-HPr complex with ADP
9S8B 2.79 Å, Structure of glycogen phosphorylase - dimeric form - in complex with HPr from…
5YA0 3.0 Å, Crystal structure of LsrK and HPr complex

Browse structure collections

About this viewer

MolViewer shows 2LRK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.