2LSG: Mouse Rev1 C-terminal domain

Solution structure of the mouse Rev1 C-terminal domain. Determined by solution NMR. Released 20 Jun 2012.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 781
Mol. weight: 11.83 kDa
Released: 20 Jun 2012

Explore 2LSG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LSG contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	18-30	13
α-helix	37-52	16
α-helix	56-72	17
α-helix	76-96	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein REV1	A	protein	104	Mus musculus	Q920Q2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LSG_1 DNA repair protein REV1 (chains A)
GSGGFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLD
LVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT

Primary citation

Multifaceted recognition of vertebrate Rev1 by translesion polymerases zeta and kappa. Wojtaszek, J., Liu, J., D'Souza, S. et al. J Biol Chem (2012) 287:26400-26408. DOI 10.1074/jbc.M112.380998 · PubMed

Other PDB entries of the same protein (UniProt Q920Q2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6C8C 1.5 Å, Chimeric Pol kappa RIR Rev1 C-terminal domain in complex with JHRE06
6C59 2.03 Å, Chimeric Pol kappa RIR Rev1 C-terminal domain
4FJO 2.72 Å, Structure of the Rev1 CTD-Rev3/7-Pol kappa RIR complex
2LSJ Solution structure of the mouse Rev1 CTD in complex with the Rev1-interacting Region…

Browse structure collections

About this viewer

MolViewer shows 2LSG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.