6C59: Chimeric Pol kappa RIR Rev1 C-terminal domain

Chimeric Pol kappa RIR Rev1 C-terminal domain. Determined by X-ray diffraction at 2.03 Å resolution. Released 12 Jun 2019.

Method: X-ray diffraction
Resolution: 2.03 Å
Organism: Mus musculus
Chains: 1
Atoms: 946
Mol. weight: 13.83 kDa
Released: 12 Jun 2019

Explore 6C59 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6C59 contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-13	8
β-strand	27	1	1
β-strand	30	1	1
α-helix	33-46	14
α-helix	52-67	16
α-helix	71-87	17
α-helix	91-112	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chimeric Pol kappa RIR Rev1 C-terminal domain	A	protein	119	Mus musculus	Q920Q2 (AlphaFold model), Q9QUG2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6C59_1 Chimeric Pol kappa RIR Rev1 C-terminal domain (chains A)
SHMKSFFDKKRSERISNGGFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVR
YCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT

Primary citation

A Small Molecule Targeting Mutagenic Translesion Synthesis Improves Chemotherapy. Wojtaszek, J.L., Chatterjee, N., Najeeb, J. et al. Cell (2019) 178:152. DOI 10.1016/j.cell.2019.05.028 · PubMed

Other PDB entries of the same protein (UniProt Q920Q2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6C8C 1.5 Å, Chimeric Pol kappa RIR Rev1 C-terminal domain in complex with JHRE06
4FJO 2.72 Å, Structure of the Rev1 CTD-Rev3/7-Pol kappa RIR complex
2LSG Solution structure of the mouse Rev1 C-terminal domain
2LSJ Solution structure of the mouse Rev1 CTD in complex with the Rev1-interacting Region…

Browse structure collections

About this viewer

MolViewer shows 6C59 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.